From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1641 [new locus tag: SAUSA300_RS08955 ]
  • pan locus tag?: SAUPAN004320000
  • symbol: gltA
  • pan gene symbol?: citZ
  • synonym:
  • product: citrate synthase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1641 [new locus tag: SAUSA300_RS08955 ]
  • symbol: gltA
  • product: citrate synthase
  • replicon: chromosome
  • strand: -
  • coordinates: 1799608..1800729
  • length: 1122
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGGCAGAATTACAAAGAGGTTTAGAAGGGGTTATCGCAGCGGAGACTAAAATAAGTTCA
    ATTATTGAAAGTCAATTGACTTATGCCGGCTATGATATTGATGATCTAGCTGAAAATGCG
    CAATTTGAAGAAGTTATTTTCCTATTATGGAACTATAGATTGCCAAACGAAGAAGAGCTT
    GCTCATCTAAAAGGGAAATTAAATCAATACATGACATTAAATCCTCGTGTGTATACACAT
    TTTGAGGAGTATGTTACAGATCACGTGCATCCAATGACAGCATTACGTACGTCATTATCA
    TATATTGCACATTTCGATCCTGATGCTGAAAATGAATCAGATGAAAATCGTTATGAAAGA
    GCAATGCGTATACAGGCTAAAGTAGCATCATTAGTTACAGCGTTTGCTCGAGTAAGACAA
    GATAAAGAACCACTTAAGCCTAATCCTGACTTAAGTTATGCGGCAAACTTCCTATATATG
    TTACGTGGGGAATTACCAACAGATATAGAAGTAGAAGCCTTCAATAAAGCACTTATTTTA
    CACGCTGATCATGAGTTGAACGCATCTGCATTTACGGCACGTTGTGCGGTATCATCATTG
    TCAGATATGTACTCAGGTATTGTAGCAGCCGTAGGTTCTCTGAAAGGGCCATTACATGGT
    GGTGCAAACGAACAAGTTATGACGATGTTATCTGAGATTGGGTCAATTGAAAATGTTGAT
    GCTTACTTAGATGAAAAATTTGCTAATAAAGATAAAGTAATGGGCTTCGGTCATCGTGTA
    TATAAAGATGGTGATCCTAGAGCGAAATATTTAAGAGAAATGAGCCGTCAAATTACGAAA
    GACGCTGGTCGTGAAGAATTATTTGAAATGTCAGTGAAAATGGAAAAACGTATGGCAGAA
    GAAAAAGGATTAATTCCTAATGTTGATTTTTATAGTGCGAGTGTTTATCACTGTATGGAA
    ATACCTCATGACTTATTCACGCCAATCTTTGCTGTAAGTCGTTCTGCAGGATGGATTGCT
    CATATTTTAGAACAATATAAAGATAATAGAATTATGCGTCCTAGAGCGAAATATATTGGC
    GAAACGAATCGTAAGTATATCCCGCTTGAAGAAAGAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1122

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_1641 [new locus tag: SAUSA300_RS08955 ]
  • symbol: GltA
  • description: citrate synthase
  • length: 373
  • theoretical pI: 5.33842
  • theoretical MW: 42593.1
  • GRAVY: -0.416086

Function[edit | edit source]

  • reaction:
    EC 2.3.3.5?  ExPASy
    2-methylcitrate synthase Propanoyl-CoA + H2O + oxaloacetate = (2S,3S)-2-hydroxybutane-1,2,3-tricarboxylate + CoA
  • TIGRFAM:
    2-methylcitrate synthase/citrate synthase II (TIGR01800; HMM-score: 490.6)
    and 2 more
    Metabolism Energy metabolism TCA cycle citrate (Si)-synthase (TIGR01798; EC 2.3.3.1; HMM-score: 263.9)
    citrate (Si)-synthase, eukaryotic (TIGR01793; EC 2.3.3.1; HMM-score: 83.6)
  • TheSEED:  
    Carbohydrates Central carbohydrate metabolism acinetobacter tca  Citrate synthase (si) (EC 2.3.3.1)
    and 3 more
    TCA Cycle  Citrate synthase (si) (EC 2.3.3.1)
    One-carbon Metabolism Serine-glyoxylate cycle  Citrate synthase (si) (EC 2.3.3.1)
    Respiration Respiration - no subcategory Biogenesis of c-type cytochromes  Citrate synthase (si) (EC 2.3.3.1)
  • PFAM:
    no clan defined Citrate_synt; Citrate synthase, C-terminal domain (PF00285; HMM-score: 425.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002539
    • TAT(Tat/SPI): 0.000292
    • LIPO(Sec/SPII): 0.000332
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAELQRGLEGVIAAETKISSIIESQLTYAGYDIDDLAENAQFEEVIFLLWNYRLPNEEELAHLKGKLNQYMTLNPRVYTHFEEYVTDHVHPMTALRTSLSYIAHFDPDAENESDENRYERAMRIQAKVASLVTAFARVRQDKEPLKPNPDLSYAANFLYMLRGELPTDIEVEAFNKALILHADHELNASAFTARCAVSSLSDMYSGIVAAVGSLKGPLHGGANEQVMTMLSEIGSIENVDAYLDEKFANKDKVMGFGHRVYKDGDPRAKYLREMSRQITKDAGREELFEMSVKMEKRMAEEKGLIPNVDFYSASVYHCMEIPHDLFTPIFAVSRSAGWIAHILEQYKDNRIMRPRAKYIGETNRKYIPLEERK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: CcpA regulon
    CcpA(TF)important in Carbon catabolism; RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]