From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1919 [new locus tag: SAUSA300_RS10525 ]
  • pan locus tag?: SAUPAN005018000
  • symbol: SAUSA300_1919
  • pan gene symbol?: scn
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1919 [new locus tag: SAUSA300_RS10525 ]
  • symbol: SAUSA300_1919
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2085861..2086211
  • length: 351
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAAAATTAGAAAATCTATACTTGCGGGAACTTTAGCAATCGTTTTAGCATCACCACTA
    GTAACTAATCTAGATAAAAATGAGGCACAAGCTAGCACAAGCTTGCCAACATCGAATGAA
    TATCAAAACGAAAAGTTAGCTAATGAATTAAAATCGTTATTAGATGAACTAAATGTTAAT
    GAATTAGCTACTGGAAGTTTAAACACTTATTATAAGCGAACTATAAAAATTTCAGGTCAA
    AAAGCAATGTATGCTCTTAAGTCAAAAGACTTTAAGAAAATGTCAGAAGCAAAATATCAA
    CTTCAAAAGATTTATAACGAAATTGACGAAGCACTAAAAAGTAAATATTAA
    60
    120
    180
    240
    300
    351


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_1919 [new locus tag: SAUSA300_RS10525 ]
  • symbol: SAUSA300_1919
  • description: hypothetical protein
  • length: 116
  • theoretical pI: 9.83807
  • theoretical MW: 13067
  • GRAVY: -0.516379

⊟Function[edit | edit source]

  • TIGRFAM:
    integral membrane protein (TIGR04561; HMM-score: 12.8)
  • TheSEED  :
    • Involved in expression of fibrinogen binding protein, phage associated
  • PFAM:
    no clan defined CompInhib_SCIN; Staphylococcal complement inhibitor SCIN (PF11546; HMM-score: 186.7)
    and 5 more
    EcoR124_C; Type I restriction and modification enzyme - subunit R C terminal (PF12008; HMM-score: 18.2)
    TPR (CL0020) M-HEAT_ATR; Serine/threonine-protein kinase ATR, M-HEAT region (PF25030; HMM-score: 17.9)
    no clan defined IDEAL; IDEAL domain (PF08858; HMM-score: 17)
    Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 14)
    HUP (CL0039) Diphthami_syn_2; Diphthamide synthase (PF01902; HMM-score: 12.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0001
    • Cell wall & surface Score: 0.0071
    • Extracellular Score: 0.9928
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: NEAQASTS
  • SignalP: Signal peptide SP(Sec/SPI) length 31 aa
    • SP(Sec/SPI): 0.966405
    • TAT(Tat/SPI): 0.009268
    • LIPO(Sec/SPII): 0.009014
    • Cleavage Site: CS pos: 31-32. AQA-ST. Pr: 0.8237
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKIRKSILAGTLAIVLASPLVTNLDKNEAQASTSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGQKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SaeR (activation) regulon
    SaeR(TF)important in Virulence; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]