From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2077 [new locus tag: SAUSA300_RS11435 ]
  • pan locus tag?: SAUPAN005415000
  • symbol: SAUSA300_2077
  • pan gene symbol?: qsrR
  • synonym:
  • product: hypothetical protein

qsrR: quinone and strong oxidant-sensing transcriptional repressor

A crystal structure is available at the Protein Data Bank at: 4HQM

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2077 [new locus tag: SAUSA300_RS11435 ]
  • symbol: SAUSA300_2077
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2239280..2239615
  • length: 336
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGAAGTATGTCCGTATCTCGAAGAAACTTTTAAAATACTTGGTAGAAGTTGGAATGGA
    TTAATCATTAATTATCTCTCAAGATGTAATGACTGTTCAGCACACTTTTCCGATATGAAA
    AGAGATTTGAAAACAATAACACCACGTGCTTTAAGTCTTAAGTTGTCAGAGCTTGCACAA
    TGGGAGTTAGTTGAGAAGCAAATCATTTCTACGAGTCCAGTACAAATTATTTATGTGCTA
    ACTGAAAAAGGTAAAGCGTTAGCAGAGGCTTTACATCCAATTGAAGCATGGGCGCAATCA
    TATGTCGATTTAACAGATCAACGTACTGCTAAATAA
    60
    120
    180
    240
    300
    336

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_2077 [new locus tag: SAUSA300_RS11435 ]
  • symbol: SAUSA300_2077
  • description: hypothetical protein
  • length: 111
  • theoretical pI: 6.50773
  • theoretical MW: 12685.6
  • GRAVY: -0.152252

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Transcriptional regulator, HxlR family
  • PFAM:
    HTH (CL0123) HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 61.6)
    and 3 more
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 15.2)
    Replic_Relax; Replication-relaxation (PF13814; HMM-score: 13.4)
    HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 12.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012963
    • TAT(Tat/SPI): 0.00073
    • LIPO(Sec/SPII): 0.026121
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MEVCPYLEETFKILGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDLTDQRTAK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

[1]

  1. ↑ Verena Nadin Fritsch, Vu Van Loi, Benno Kuropka, Martin Gruhlke, Christoph Weise, Haike Antelmann
    The MarR/DUF24-Family QsrR Repressor Senses Quinones and Oxidants by Thiol Switch Mechanisms in Staphylococcus aureus.
    Antioxid Redox Signal: 2023, 38(13-15);877-895
    [PubMed:36242097] [WorldCat.org] [DOI] (I p)
Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_2077&oldid=104147"