Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2305 [new locus tag: SAUSA300_RS12740 ]
- pan locus tag?: SAUPAN005867000
- symbol: SAUSA300_2305
- pan gene symbol?: —
- synonym:
- product: transposase, truncation
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2305 [new locus tag: SAUSA300_RS12740 ]
- symbol: SAUSA300_2305
- product: transposase, truncation
- replicon: chromosome
- strand: +
- coordinates: 2478538..2478894
- length: 357
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3912876 NCBI
- RefSeq: YP_494940 NCBI
- BioCyc: see SAUSA300_RS12740
- MicrobesOnline: 1293820 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATTCAAAATACCTTCGGTTATTTACCGGAGTATATTGTAGCTGATGCATGTTATGAT
AGTGAGCAAAACTATATGGCTATTATAGATGATTTTAATAAAACGCCACTTATTACGTAT
GTCATGTTTATTAAAGATAAAACTAGAAAGTTTAAAAGTGACATTTTTAACACTCAAAAT
TGGAAATATGACGAACTTAATGATGAATTTATATGTCCTAATAACAAAAGAATAGGTTTT
AAAAGATATGCATACCATAATGATAGATATGGTTTTAAACGTGACTTCAAGCTATATGAA
TGCAACGAGCTGTACATTATAAAATACATATCAAAAAAGCTGATTTCTATCAAATAA60
120
180
240
300
357
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2305 [new locus tag: SAUSA300_RS12740 ]
- symbol: SAUSA300_2305
- description: transposase, truncation
- length: 118
- theoretical pI: 8.71121
- theoretical MW: 14415.5
- GRAVY: -0.60339
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5872
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.412
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010926
- TAT(Tat/SPI): 0.000151
- LIPO(Sec/SPII): 0.024682
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIQNTFGYLPEYIVADACYDSEQNYMAIIDDFNKTPLITYVMFIKDKTRKFKSDIFNTQNWKYDELNDEFICPNNKRIGFKRYAYHNDRYGFKRDFKLYECNELYIIKYISKKLISIK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]