From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2342 [new locus tag: SAUSA300_RS12930 ]
  • pan locus tag?: SAUPAN005927000
  • symbol: narH
  • pan gene symbol?: narH
  • synonym:
  • product: respiratory nitrate reductase, beta subunit

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2342 [new locus tag: SAUSA300_RS12930 ]
  • symbol: narH
  • product: respiratory nitrate reductase, beta subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 2515243..2516688
  • length: 1446
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    ATGTGGTTCAACAACGTAGAAACGAAGCCAGGTGTAGGGTATCCGAAACGTTGGGAAGAC
    CAAGAACACTACAAAGGTGGTTGGGTACTAAATCGTAAAGGGAAACTTGAATTAAAATCT
    GGAAGTAGAATTTCAAAAATTGCTTTAGGTAAAATTTTTTATAACCCAGATATGCCATTA
    ATTAAAGATTATTATGAGCCATGGAACTATAATTATGAACATTTAACAACTGCGAAATCA
    GGGAAGCATTCGCCAGTTGCTAGAGCGTATTCAGAAATTACGGGGGATAACATTGAAATT
    GAATGGGGACCTAACTGGGAAGATGACTTAGCAGGTGGTCATGTTACAGGTCCAAAAGAT
    CCTAACATCCAAAAAATAGAAGAAGATATTAAATTCCAATTTGACGAAACTTTTATGATG
    TATTTACCACGTTTATGTGAACATTGCTTGAATCCAAGTTGCGTTGCATCGTGTCCTTCA
    GGTGCTATGTATAAACGTGATGAAGATGGCATTGTATTAGTTGACCAAGACGCATGTCGT
    GGATGGCGTTACTGTATGACAGGTTGTCCATATAAGAAAGTTTACTTCAATTGGAAAACG
    AACAAAGCTGAAAAGTGTACTTTCTGTTTCCCGAGAATCGAGGCGGGTATGCCTACGGTA
    TGCTCTGAAACTTGTACAGGACGTATGCGTTACTTAGGTGTTTTATTATATGATGCAGAT
    CGAGTTCATGAAGCAGCTTCAGCAGTAGACGAGAAAGATTTATATGAAAAACAATTAGAT
    ATATTCTTAAACCCATTTGACGAAGAAGTCATTGCTCAAGCTGAAAAAGATGGTATTGGT
    TACGATTGGATTGAAGCTGCACAAAACTCTCCAATTTATAAGTTAGCAATTGAATATAAA
    CTTGCATTTCCGTTACATCCTGAATTTAGAACGATGCCGATGGTTTGGTATTGCCCACCA
    CTTAGCCCAATTATGAGCTATTTTGAAGGTAAAAATACAACTCAAAATCCAGATGCGATT
    TTCCCAGCCATTGAAGAAATGCGTTTACCTATTGAATACTTAGCTAATATTTTCACTGCA
    GGAGATACAGAGCCAGTAAAAGGAGCCCTACAACGTATGGCAATGATGAGAAGTTATATG
    AGATCTCAAGTTACTCAACAGCCATTTGACACGTCTCGATTAGAGCGATTAGGTATAACC
    GAGCGCCAAACTAAAGACATGTATCGTTTATTAGGACTAGCCAAATATGAAGATCGATTT
    GTTATTCCAACATCACACAAAGAAACCTATTTAGATACGTATCACGCACAAGGTAGTACA
    GGATACAATTACGGCGGCGAGCATTTTGGAGATAACTGTGAAGGCTGTGGCGTTGCAGTA
    GGTTCAGGGAAAACTGGTCAAGAAATTTATAATGAGAATTTCTATGGAGGGATTTTCCGT
    GATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1446

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2342 [new locus tag: SAUSA300_RS12930 ]
  • symbol: NarH
  • description: respiratory nitrate reductase, beta subunit
  • length: 481
  • theoretical pI: 5.09989
  • theoretical MW: 55219.2
  • GRAVY: -0.570478

Function[edit | edit source]

  • reaction:
    EC 1.7.99.4?  ExPASy
    Nitrate reductase Nitrite + acceptor = nitrate + reduced acceptor
  • TIGRFAM:
    Metabolism Energy metabolism Anaerobic nitrate reductase, beta subunit (TIGR01660; EC 1.7.99.4; HMM-score: 749.6)
    and 15 more
    Metabolism Energy metabolism Anaerobic DMSO reductase family type II enzyme, iron-sulfur subunit (TIGR03478; HMM-score: 221.3)
    Metabolism Energy metabolism Electron transport DMSO reductase family type II enzyme, iron-sulfur subunit (TIGR03478; HMM-score: 221.3)
    dimethylsulfoxide reductase, chain B (TIGR02951; HMM-score: 95.1)
    Metabolism Energy metabolism Electron transport cytochrome c nitrite reductase, Fe-S protein (TIGR03149; EC 1.7.2.2; HMM-score: 80.6)
    Metabolism Energy metabolism Anaerobic formate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 61.4)
    Metabolism Energy metabolism Electron transport formate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 61.4)
    [FeFe] hydrogenase, group B1/B3 (TIGR04105; EC 1.12.-.-; HMM-score: 23.2)
    Unknown function General archaeoflavoprotein, MJ0208 family (TIGR02700; HMM-score: 20.2)
    methylamine methyltransferase corrinoid protein reductive activase (TIGR04270; HMM-score: 15.5)
    Genetic information processing Protein fate Protein modification and repair glycine radical enzyme activase, YjjW family (TIGR04041; EC 1.97.1.-; HMM-score: 15.2)
    2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family (TIGR02179; HMM-score: 15.1)
    Metabolism Energy metabolism Amino acids and amines choline TMA-lyase-activating enzyme (TIGR04395; EC 1.97.-.-; HMM-score: 14.5)
    Metabolism Central intermediary metabolism Sulfur metabolism sulfite reductase, dissimilatory-type beta subunit (TIGR02066; EC 1.8.99.3; HMM-score: 11.3)
    Metabolism Energy metabolism Other benzoyl-CoA oxygenase/reductase, BoxA protein (TIGR03224; EC 1.14.12.21; HMM-score: 8.2)
    Metabolism Energy metabolism Methanogenesis putative methanogenesis marker 16 metalloprotein (TIGR03287; HMM-score: 6.9)
  • TheSEED:  
    Nitrogen Metabolism Nitrogen Metabolism - no subcategory Nitrate and nitrite ammonification  Respiratory nitrate reductase beta chain (EC 1.7.99.4)
  • PFAM:
    4Fe-4S (CL0344) Fer4_11; 4Fe-4S dicluster domain (PF13247; HMM-score: 124.5)
    no clan defined Nitr_red_bet_C; Respiratory nitrate reductase beta C-terminal (PF14711; HMM-score: 100.5)
    and 4 more
    4Fe-4S (CL0344) Fer4_10; 4Fe-4S dicluster domain (PF13237; HMM-score: 22.2)
    Fer4_6; 4Fe-4S binding domain (PF12837; HMM-score: 19)
    Fer4_7; 4Fe-4S dicluster domain (PF12838; HMM-score: 16.9)
    Fer4_9; 4Fe-4S dicluster domain (PF13187; HMM-score: 16.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013888
    • TAT(Tat/SPI): 0.000537
    • LIPO(Sec/SPII): 0.002113
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MWFNNVETKPGVGYPKRWEDQEHYKGGWVLNRKGKLELKSGSRISKIALGKIFYNPDMPLIKDYYEPWNYNYEHLTTAKSGKHSPVARAYSEITGDNIEIEWGPNWEDDLAGGHVTGPKDPNIQKIEEDIKFQFDETFMMYLPRLCEHCLNPSCVASCPSGAMYKRDEDGIVLVDQDACRGWRYCMTGCPYKKVYFNWKTNKAEKCTFCFPRIEAGMPTVCSETCTGRMRYLGVLLYDADRVHEAASAVDEKDLYEKQLDIFLNPFDEEVIAQAEKDGIGYDWIEAAQNSPIYKLAIEYKLAFPLHPEFRTMPMVWYCPPLSPIMSYFEGKNTTQNPDAIFPAIEEMRLPIEYLANIFTAGDTEPVKGALQRMAMMRSYMRSQVTQQPFDTSRLERLGITERQTKDMYRLLGLAKYEDRFVIPTSHKETYLDTYHAQGSTGYNYGGEHFGDNCEGCGVAVGSGKTGQEIYNENFYGGIFRD

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: NreC* (activation) regulon, Rex (repression) regulon
    NreC(TF)important in Nitrate and nitrite respiration; RegPrecise    transcription unit transferred from N315 data RegPrecise  
    Rex(TF)important in Energy metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]