From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2184 [new locus tag: SA_RS12530 ]
  • pan locus tag?: SAUPAN005927000
  • symbol: narH
  • pan gene symbol?: narH
  • synonym:
  • product: nitrate reductase subunit beta NarH

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2184 [new locus tag: SA_RS12530 ]
  • symbol: narH
  • product: nitrate reductase subunit beta NarH
  • replicon: chromosome
  • strand: -
  • coordinates: 2451164..2452723
  • length: 1560
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    1381
    1441
    1501
    TTGAAGATTAAAGCGCAAGTTGCGATGGTATTAAATTTAGATAAATGCATAGGATGCCAT
    ACGTGTAGTGTGACATGTAAAAACACTTGGACAAATCGTCCAGGTGCTGAGTACATGTGG
    TTCAATAACGTAGAAACGAAGCCAGGTGTAGGGTATCCGAAACGTTGGGAAGACCAAGAA
    CACTACAAAGGTGGTTGGGTACTAAATCGTAAAGGGAAACTTGAATTAAAATCTGGAAGT
    AGAATTTCAAAAATTGCTTTAGGTAAAATTTTTTATAACCCAGATATGCCATTAATAAAA
    GATTATTATGAACCATGGAACTATAATTATGAACATTTAACAACTGCGAAATCAGGGAAG
    CATTCGCCAGTTGCTAGAGCGTATTCAGAAATTACAGGGGATAACATTGAAATTGAATGG
    GGACCTAACTGGGAAGATGACTTAGCAGGTGGTCATGTTACAGGCCCAAAAGATCCTAAC
    ATCCAAAAAATAGAAGAAGATATTAAATTCCAATTTGACGAAACTTTTATGATGTATTTA
    CCACGTTTATGTGAACATTGCTTGAATCCAAGTTGCGTTGCATCGTGCCCTTCAGGTGCT
    ATGTATAAACGTGATGAAGATGGCATTGTATTAGTTGATCAAGACGCATGTCGTGGATGG
    CGTTACTGTATGACAGGTTGTCCATATAAGAAAGTTTACTTCAATTGGAAAACGAACAAA
    GCTGAAAAATGTACTTTCTGTTTTCCGAGAATCGAGGCGGGTATGCCTACGGTATGCTCT
    GAAACTTGTACAGGACGTATGCGTTACTTAGGTGTTTTATTATATGATGCAGATCGAGTT
    CATGAAGCGGCTTCAGCAGTAGACGAGAAAGGTTTATACGAAAAACAATTAGATATATTC
    TTAAATCCATTTGACGAAGAAGTCATTGCTCAAGCTGAAAAAGATGGTATTGGTTATGAT
    TGGATTGAAGCTGCACAAAACTCTCCAATTTATAAGTTAGCAATTGAATATAAACTTGCA
    TTTCCGTTACATCCTGAATTTAGAACGATGCCGATGGTTTGGTATTGCCCACCACTTAGC
    CCAATTATGAGCTATTTTGAAGGTAAAAATACAACTCAAAATCCAGATGCGATTTTCCCA
    GCCATTGAAGAAATGCGTTTACCTATTGAATACTTAGCTAATATTTTCACTGCAGGAGAT
    ACAGAGCCAGTAAAAGGAGCCCTACAACGTATGGCAATGATGAGAAGTTATATGAGATCT
    CAAGTTACTCAACAGCCATTTGACACGTCTCGATTAGAGCGATTAGGTATAACCGAGCGC
    CAAACTAAAGACATGTATCGTTTATTAGGACTAGCTAAATATGAAGATCGATTTGTTATT
    CCAACATCACACAAAGAAACCTATTTAGATACGTATCACGCACAAGGTAGTACAGGATAC
    AATTACGGCGGCGAGCATTTTGGAGATAACTGTGAAGGCTGTGGCGTTGCAGTAGGTTCA
    GGGAAAACTGGTCAAGAAATTTATAATGAGAATTTCTATGGAGGGATTTTCCGTGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1380
    1440
    1500
    1560

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2184 [new locus tag: SA_RS12530 ]
  • symbol: NarH
  • description: nitrate reductase subunit beta NarH
  • length: 519
  • theoretical pI: 5.68879
  • theoretical MW: 59372.2
  • GRAVY: -0.530636

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Anaerobic nitrate reductase, beta subunit (TIGR01660; EC 1.7.99.4; HMM-score: 837.9)
    and 21 more
    Metabolism Energy metabolism Anaerobic DMSO reductase family type II enzyme, iron-sulfur subunit (TIGR03478; HMM-score: 288.7)
    Metabolism Energy metabolism Electron transport DMSO reductase family type II enzyme, iron-sulfur subunit (TIGR03478; HMM-score: 288.7)
    dimethylsulfoxide reductase, chain B (TIGR02951; HMM-score: 107)
    Metabolism Energy metabolism Electron transport cytochrome c nitrite reductase, Fe-S protein (TIGR03149; EC 1.7.2.2; HMM-score: 86.6)
    Metabolism Energy metabolism Anaerobic formate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 71.9)
    Metabolism Energy metabolism Electron transport formate dehydrogenase, beta subunit (TIGR01582; EC 1.2.1.2; HMM-score: 71.9)
    [FeFe] hydrogenase, group B1/B3 (TIGR04105; EC 1.12.-.-; HMM-score: 22.6)
    Unknown function General archaeoflavoprotein, MJ0208 family (TIGR02700; HMM-score: 22.3)
    2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family (TIGR02179; HMM-score: 16.2)
    Genetic information processing Protein fate Protein modification and repair glycine radical enzyme activase, YjjW family (TIGR04041; EC 1.97.1.-; HMM-score: 15.7)
    Metabolism Central intermediary metabolism Nitrogen fixation ferredoxin III, nif-specific (TIGR02936; HMM-score: 14.9)
    methylamine methyltransferase corrinoid protein reductive activase (TIGR04270; HMM-score: 14.8)
    Metabolism Energy metabolism Amino acids and amines choline TMA-lyase-activating enzyme (TIGR04395; EC 1.97.-.-; HMM-score: 14.5)
    glycyl-radical enzyme activating protein (TIGR02494; EC 1.97.1.-; HMM-score: 12.2)
    Metabolism Central intermediary metabolism Sulfur metabolism sulfite reductase, dissimilatory-type beta subunit (TIGR02066; EC 1.8.99.3; HMM-score: 10.9)
    coenzyme F420 hydrogenase, subunit gamma (TIGR03294; EC 1.12.98.1; HMM-score: 9.2)
    [FeFe] hydrogenase, group A (TIGR02512; EC 1.12.-.-; HMM-score: 8.1)
    Metabolism Energy metabolism Electron transport electron transport complex, RnfABCDGE type, B subunit (TIGR01944; HMM-score: 5.8)
    Metabolism Energy metabolism Methanogenesis putative methanogenesis marker 16 metalloprotein (TIGR03287; HMM-score: 4.3)
    Metabolism Central intermediary metabolism Sulfur metabolism sulfite reductase, subunit C (TIGR02912; EC 1.8.-.-; HMM-score: 4)
    Metabolism Energy metabolism Other benzoyl-CoA oxygenase/reductase, BoxA protein (TIGR03224; EC 1.14.12.21; HMM-score: 3.9)
  • TheSEED:  
    Nitrogen Metabolism Nitrogen Metabolism - no subcategory Nitrate and nitrite ammonification  Respiratory nitrate reductase beta chain (EC 1.7.99.4)
  • PFAM:
    4Fe-4S (CL0344) Fer4_11; 4Fe-4S dicluster domain (PF13247; HMM-score: 123.6)
    no clan defined Nitr_red_bet_C; Respiratory nitrate reductase beta C-terminal (PF14711; HMM-score: 100.3)
    and 10 more
    4Fe-4S (CL0344) Fer4_10; 4Fe-4S dicluster domain (PF13237; HMM-score: 29.6)
    Fer4_7; 4Fe-4S dicluster domain (PF12838; HMM-score: 24.7)
    Fer4_6; 4Fe-4S binding domain (PF12837; HMM-score: 22)
    Fer4_9; 4Fe-4S dicluster domain (PF13187; HMM-score: 19.2)
    Fer4_2; 4Fe-4S binding domain (PF12797; HMM-score: 15.5)
    Fer4; 4Fe-4S binding domain (PF00037; HMM-score: 15)
    Fer4_13; 4Fe-4S single cluster domain of Ferredoxin I (PF13370; HMM-score: 13.8)
    Fer4_8; 4Fe-4S dicluster domain (PF13183; HMM-score: 11.7)
    Fer4_21; 4Fe-4S dicluster domain (PF14697; HMM-score: 9.1)
    Fer4_4; 4Fe-4S binding domain (PF12800; HMM-score: 8.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.193248
    • TAT(Tat/SPI): 0.002364
    • LIPO(Sec/SPII): 0.257463
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKIKAQVAMVLNLDKCIGCHTCSVTCKNTWTNRPGAEYMWFNNVETKPGVGYPKRWEDQEHYKGGWVLNRKGKLELKSGSRISKIALGKIFYNPDMPLIKDYYEPWNYNYEHLTTAKSGKHSPVARAYSEITGDNIEIEWGPNWEDDLAGGHVTGPKDPNIQKIEEDIKFQFDETFMMYLPRLCEHCLNPSCVASCPSGAMYKRDEDGIVLVDQDACRGWRYCMTGCPYKKVYFNWKTNKAEKCTFCFPRIEAGMPTVCSETCTGRMRYLGVLLYDADRVHEAASAVDEKGLYEKQLDIFLNPFDEEVIAQAEKDGIGYDWIEAAQNSPIYKLAIEYKLAFPLHPEFRTMPMVWYCPPLSPIMSYFEGKNTTQNPDAIFPAIEEMRLPIEYLANIFTAGDTEPVKGALQRMAMMRSYMRSQVTQQPFDTSRLERLGITERQTKDMYRLLGLAKYEDRFVIPTSHKETYLDTYHAQGSTGYNYGGEHFGDNCEGCGVAVGSGKTGQEIYNENFYGGIFRD

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulators: Rex* (repression) regulon, NreC* (activation) regulon
    Rex(TF)important in Energy metabolism; RegPrecise  
    NreC(TF)important in Nitrate and nitrite respiration; RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]