From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2353 [new locus tag: SAUSA300_RS12990 ]
  • pan locus tag?: SAUPAN005940000
  • symbol: SAUSA300_2353
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

yefM1: type II addiction module ribosome-dependent RNase antitoxin YefM1

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2353 [new locus tag: SAUSA300_RS12990 ]
  • symbol: SAUSA300_2353
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2530348..2530599
  • length: 252
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGATTATTAAAAATTATTCATACGCTCGACAGAATTTAAAGGCACTTATGACAAAAGTA
    AATGATGATAGTGTTATGGTAACTGTAACATCTACTGATGATAAAAACGTAGTAATCATG
    TCAGAATCAGATTATAACTCCATGATGGAAACACTTTACCTCCAACAGAACCCAAATAAT
    GCTGAACACTTAGCTCAATCAATTGCAGATCTAGAACGTGGGAAAACTATAACGAAAGAT
    ATAGATGTATAA
    60
    120
    180
    240
    252

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_2353 [new locus tag: SAUSA300_RS12990 ]
  • symbol: SAUSA300_2353
  • description: hypothetical protein
  • length: 83
  • theoretical pI: 4.47038
  • theoretical MW: 9417.61
  • GRAVY: -0.454217

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance prevent-host-death family protein (TIGR01552; HMM-score: 27.4)
    Genetic information processing Mobile and extrachromosomal element functions Other prevent-host-death family protein (TIGR01552; HMM-score: 27.4)
  • TheSEED  :
    • YefM protein (antitoxin to YoeB)
  • PFAM:
    Plasmid-antitox (CL0136) PhdYeFM_antitox; Antitoxin Phd_YefM, type II toxin-antitoxin system (PF02604; HMM-score: 74.3)
    and 2 more
    no clan defined DUF2187; Uncharacterized protein conserved in bacteria (DUF2187) (PF09953; HMM-score: 15.4)
    DUF3841; Domain of unknown function (DUF3841) (PF12952; HMM-score: 12.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005555
    • TAT(Tat/SPI): 0.000219
    • LIPO(Sec/SPII): 0.001084
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MIIKNYSYARQNLKALMTKVNDDSVMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPNNAEHLAQSIADLERGKTITKDIDV

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

[1]

  1. ↑ Xinyu Qi, Kimberly M Brothers, Dongzhu Ma, Jonathan B Mandell, Niles P Donegan, Ambrose L Cheung, Anthony R Richardson, Kenneth L Urish
    The Staphylococcus aureus toxin-antitoxin system YefM-YoeB is associated with antibiotic tolerance and extracellular dependent biofilm formation.
    J Bone Jt Infect: 2021, 6(7);241-253
    [PubMed:34262845] [WorldCat.org] [DOI] (P e)
Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_2353&oldid=104108"