From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2352 [new locus tag: SAUSA300_RS12985 ]
  • pan locus tag?: SAUPAN005939000
  • symbol: SAUSA300_2352
  • pan gene symbol?:
  • synonym:
  • product: addiction module antitoxin

yoeB1: type II addiction module ribosome-dependent RNase toxin YoeB1

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2352 [new locus tag: SAUSA300_RS12985 ]
  • symbol: SAUSA300_2352
  • product: addiction module antitoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 2530082..2530348
  • length: 267
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCTAGGTTAAATATTACGTTTTCGCCTCAAGCCTTTGAAGATTATAAGTATTTTCAG
    CAGAACGATAAAAAAATGGTGAAGAAGATTAATGAGTTACTTAAAAGTATTGACAGAAAT
    GGTGCATTGGAAGGTATAGGTAAGCCTGAAAAGTTAAAATCGAATCTGACTGGGTATTAT
    AGTAGACGTATCAATCACGAACATAGATTGGTTTATACAGTAGATGACAATCATATAAAA
    ATAGCATCATGTAAATACCATTATTAA
    60
    120
    180
    240
    267

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2352 [new locus tag: SAUSA300_RS12985 ]
  • symbol: SAUSA300_2352
  • description: addiction module antitoxin
  • length: 88
  • theoretical pI: 9.92069
  • theoretical MW: 10437.9
  • GRAVY: -0.859091

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 106.7)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 106.7)
    and 3 more
    Cellular processes Cellular processes Toxin production and resistance addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 27)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 27)
    Cellular processes Cellular processes Adaptations to atypical conditions addiction module toxin component, YafQ family (TIGR00053; HMM-score: 22.3)
  • TheSEED  :
    • FIG01108752: hypothetical protein
  • PFAM:
    Plasmid_toxin (CL0136) YoeB_toxin; YoeB-like toxin of bacterial type II toxin-antitoxin system (PF06769; HMM-score: 130.3)
    and 4 more
    ParE_toxin; ParE toxin of type II toxin-antitoxin system, parDE (PF05016; HMM-score: 22.2)
    YafQ_toxin; Bacterial toxin of type II toxin-antitoxin system, YafQ (PF15738; HMM-score: 22.2)
    HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 20.2)
    ParE_like; ParE-like toxin domain (PF24732; HMM-score: 14.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9196
    • Cytoplasmic Membrane Score: 0.002
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0782
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004202
    • TAT(Tat/SPI): 0.000288
    • LIPO(Sec/SPII): 0.000318
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIKIASCKYHY

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

[1]

  1. Xinyu Qi, Kimberly M Brothers, Dongzhu Ma, Jonathan B Mandell, Niles P Donegan, Ambrose L Cheung, Anthony R Richardson, Kenneth L Urish
    The Staphylococcus aureus toxin-antitoxin system YefM-YoeB is associated with antibiotic tolerance and extracellular dependent biofilm formation.
    J Bone Jt Infect: 2021, 6(7);241-253
    [PubMed:34262845] [WorldCat.org] [DOI] (P e)