From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2404 [new locus tag: SACOL_RS12615 ]
  • pan locus tag?: SAUPAN005939000
  • symbol: SACOL2404
  • pan gene symbol?: —
  • synonym:
  • product: addiction module antitoxin

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2404 [new locus tag: SACOL_RS12615 ]
  • symbol: SACOL2404
  • product: addiction module antitoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 2466516..2466782
  • length: 267
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCTAGGTTAAATATTACGTTTTCGCCTCAAGCCTTTGAAGATTATAAGTATTTTCAG
    CAGAACGATAAAAAAATGGTGAAGAAGATTAATGAGTTACTTAAAAGTATTGACAGAAAT
    GGTGCATTGGAAGGTATAGGTAAGCCTGAAAAGTTAAAATCGAATCTGACTGGGTATTAT
    AGTAGACGTATCAATCACGAACATAGATTGGTTTATACAGTAGATGACAATCATATAAAA
    ATAGCATCATGTAAATACCATTATTAA
    60
    120
    180
    240
    267

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2404 [new locus tag: SACOL_RS12615 ]
  • symbol: SACOL2404
  • description: addiction module antitoxin
  • length: 88
  • theoretical pI: 9.92069
  • theoretical MW: 10437.9
  • GRAVY: -0.859091

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 106.7)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 106.7)
    and 3 more
    Cellular processes Cellular processes Toxin production and resistance addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 27)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 27)
    Cellular processes Cellular processes Adaptations to atypical conditions addiction module toxin component, YafQ family (TIGR00053; HMM-score: 22.3)
  • TheSEED  :
    • FIG01108752: hypothetical protein
  • PFAM:
    Plasmid-antitox (CL0136) YoeB_toxin; YoeB-like toxin of bacterial type II toxin-antitoxin system (PF06769; HMM-score: 131.1)
    and 3 more
    YafQ_toxin; Bacterial toxin of type II toxin-antitoxin system, YafQ (PF15738; HMM-score: 23.4)
    HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 20.1)
    ParE_toxin; ParE toxin of type II toxin-antitoxin system, parDE (PF05016; HMM-score: 19.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004202
    • TAT(Tat/SPI): 0.000288
    • LIPO(Sec/SPII): 0.000318
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MARLNITFSPQAFEDYKYFQQNDKKMVKKINELLKSIDRNGALEGIGKPEKLKSNLTGYYSRRINHEHRLVYTVDDNHIKIASCKYHY

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

[1]

  1. ↑ Xinyu Qi, Kimberly M Brothers, Dongzhu Ma, Jonathan B Mandell, Niles P Donegan, Ambrose L Cheung, Anthony R Richardson, Kenneth L Urish
    The Staphylococcus aureus toxin-antitoxin system YefM-YoeB is associated with antibiotic tolerance and extracellular dependent biofilm formation.
    J Bone Jt Infect: 2021, 6(7);241-253
    [PubMed:34262845] [WorldCat.org] [DOI] (P e)
Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL2404&oldid=104048"