Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2428
- pan locus tag?: SAUPAN006077000
- symbol: SAUSA300_2428
- pan gene symbol?: —
- synonym:
- product: tandem lipoprotein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2428
- symbol: SAUSA300_2428
- product: tandem lipoprotein
- replicon: chromosome
- strand: -
- coordinates: 2612848..2613090
- length: 243
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID: 3913521 NCBI
- RefSeq: YP_495062 NCBI
- BioCyc: GH3C-2414 BioCyc
- MicrobesOnline: 1293943 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241GTGCCAAGTTATTCTGCAAAGTATCAATTGAATAATGATGACTATAATGTTCAACAGTTA
AGAAAACGATATCATATTCCAACCAAACAAGCGCCCGAATTAAAATTGAAAGGATCCGGC
AATTTAAAAGGCTCATCCGTAGGATCTAAGGATCTAGAATTTACGTTTGTAGAAAATCAA
GAAGAGAATATCTATTTTTCAGATTCGGTCGAATTTACACCTAGCGAGGATGATAAATCA
TGA60
120
180
240
243
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2428
- symbol: SAUSA300_2428
- description: tandem lipoprotein
- length: 80
- theoretical pI: 4.76773
- theoretical MW: 9182.98
- GRAVY: -1.08375
⊟Function[edit | edit source]
- TIGRFAM: Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 99.7)
- TheSEED :
- FIG01107840: hypothetical protein
- PFAM: LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 128.2)and 1 moreno clan defined Integrase_Zn; Integrase Zinc binding domain (PF02022; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009982
- TAT(Tat/SPI): 0.00068
- LIPO(Sec/SPII): 0.000745
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPSYSAKYQLNNDDYNVQQLRKRYHIPTKQAPELKLKGSGNLKGSSVGSKDLEFTFVENQEENIYFSDSVEFTPSEDDKS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]