Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_2514 [new locus tag: SAUSA300_RS13955 ]
- pan locus tag?: SAUPAN006251000
- symbol: SAUSA300_2514
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_2514 [new locus tag: SAUSA300_RS13955 ]
- symbol: SAUSA300_2514
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2717931..2718230
- length: 300
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3913466 NCBI
- RefSeq: YP_495148 NCBI
- BioCyc: see SAUSA300_RS13955
- MicrobesOnline: 1294029 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTCTTTAAATAAAGAGCAAAGACGCATCACAGCTGAAGAGTTGCAAGCACATTTCGAA
GCATCTACCTTATCGGTTCAAATGATTGCTGAAAAACTGAATGTCACTACAGAAGATGTG
GAAAAAGTATTAGCTATGACAGCGCCACTAGGCATTTTTAGTCATCAATTACAACGATTT
ATTCATTTAGTATGGGATGTCAGAGATGTAATAAACGACAATATTAAAGGAAATGGACAA
ACACCAGAACCATATACGTATTTAAAAGGTGAAAAAGAGGACTATTGGTTTTTAAGATAA60
120
180
240
300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_2514 [new locus tag: SAUSA300_RS13955 ]
- symbol: SAUSA300_2514
- description: hypothetical protein
- length: 99
- theoretical pI: 5.14368
- theoretical MW: 11536
- GRAVY: -0.450505
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions phage-associated protein, BcepMu gp16 family (TIGR04111; HMM-score: 18.7)
- TheSEED :
- FIG01108185: hypothetical protein
- PFAM: HTH (CL0123) DUF2316; Uncharacterized protein conserved in bacteria (DUF2316) (PF10078; HMM-score: 106.7)and 6 morePCI; PCI domain (PF01399; HMM-score: 17.9)HTH_11; HTH domain (PF08279; HMM-score: 14)HTH_69; Winged helix-turn-helix domain (PF22979; HMM-score: 13.7)HTH_Cmi2_C; Cmi2, C-terminal (PF24270; HMM-score: 13.4)IF2_N; Translation initiation factor IF-2, N-terminal region (PF04760; HMM-score: 12.6)Sigma70_r3; Sigma-70 region 3 (PF04539; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.958
- Cytoplasmic Membrane Score: 0.0265
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0154
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00198
- TAT(Tat/SPI): 0.000666
- LIPO(Sec/SPII): 0.000384
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSLNKEQRRITAEELQAHFEASTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]