From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2592 [new locus tag: SACOL_RS13575 ]
  • pan locus tag?: SAUPAN006251000
  • symbol: SACOL2592
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2592 [new locus tag: SACOL_RS13575 ]
  • symbol: SACOL2592
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2654627..2654926
  • length: 300
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGTCTTTAAATAAAGAGCAAAGACGCATCACAGCTGAAGAGTTGCAAGCACATTTCGAA
    GCATCTACCTTATCGGTTCAAATGATTGCTGAAAAACTGAATGTCACTACAGAAGATGTG
    GAAAAAGTATTAGCTATGACAGCGCCACTAGGCATTTTTAGTCATCAATTACAACGATTT
    ATTCATTTAGTATGGGATGTCAGAGATGTAATAAACGACAATATTAAAGGAAATGGACAA
    ACACCAGAACCATATACGTATTTAAAAGGTGAAAAAGAGGACTATTGGTTTTTAAGATAA
    60
    120
    180
    240
    300

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2592 [new locus tag: SACOL_RS13575 ]
  • symbol: SACOL2592
  • description: hypothetical protein
  • length: 99
  • theoretical pI: 5.14368
  • theoretical MW: 11536
  • GRAVY: -0.450505

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage-associated protein, BcepMu gp16 family (TIGR04111; HMM-score: 18.7)
  • TheSEED  :
    • FIG01108185: hypothetical protein
  • PFAM:
    HTH (CL0123) DUF2316; Uncharacterized protein conserved in bacteria (DUF2316) (PF10078; HMM-score: 123.1)
    and 6 more
    PCI; PCI domain (PF01399; HMM-score: 15.9)
    HTH_11; HTH domain (PF08279; HMM-score: 15.2)
    no clan defined DUF2999; Protein of unknown function (DUF2999) (PF11212; HMM-score: 13.1)
    HTH (CL0123) Sigma70_r3; Sigma-70 region 3 (PF04539; HMM-score: 12.4)
    IF2_N; Translation initiation factor IF-2, N-terminal region (PF04760; HMM-score: 12.4)
    no clan defined DUF4026; Protein of unknown function (DUF4026) (PF13218; HMM-score: 11.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00198
    • TAT(Tat/SPI): 0.000666
    • LIPO(Sec/SPII): 0.000384
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSLNKEQRRITAEELQAHFEASTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]