Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2590 [new locus tag: SACOL_RS13565 ]
- pan locus tag?: SAUPAN006248000
- symbol: SACOL2590
- pan gene symbol?: —
- synonym:
- product: glyoxalase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2590 [new locus tag: SACOL_RS13565 ]
- symbol: SACOL2590
- product: glyoxalase
- replicon: chromosome
- strand: -
- coordinates: 2653392..2653769
- length: 378
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237197 NCBI
- RefSeq: YP_187381 NCBI
- BioCyc: see SACOL_RS13565
- MicrobesOnline: 914060 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATTCAATCAATGTGGTTTAATTTGCATGTGCAAGATTTAGAAAAGAGCGCACAGTTT
TATAAAGCGTTAGGATTTAAAATAAATAGAAACCCACAAATGTTAGATAAAATGGTCGGC
ATTCAAATAGGTCAAACAACCGTAATTTTAATAGAAAACAAGCATTTTCAAAATGTAAGT
CAGCAAAGCCTTAATACTGAACCAAATGAAGTGATGATTTCTCTAGGTGTGAACACAAAT
GAAGAAGTTGACCAGTTGGTGAATAAAGTGAAAGAAGCGGGTGGCACAGTCGTTCAAGAA
CCAACAGTAAGCCAAGGGTTTTATGGAGCAATGTTCAAAGATCTTGATGGACACCATTTT
AATTTTTTGGTCTGCTAA60
120
180
240
300
360
378
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2590 [new locus tag: SACOL_RS13565 ]
- symbol: SACOL2590
- description: glyoxalase
- length: 125
- theoretical pI: 5.54363
- theoretical MW: 14160.1
- GRAVY: -0.2224
⊟Function[edit | edit source]
- TIGRFAM: 3,4-dihydroxyphenylacetate 2,3-dioxygenase (TIGR02295; EC 1.13.11.15; HMM-score: 23.8)Energy metabolism Other lactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 23)Central intermediary metabolism Amino sugars lactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 23)
- TheSEED :
- hypothetical protein
- PFAM: Glyoxalase (CL0104) Ble-like_N; Bleomycin resistance protein-like N-terminal (PF22677; HMM-score: 64.4)and 7 moreGlyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 40.5)Glyoxalase_6; Glyoxalase-like domain (PF18029; HMM-score: 30.8)no clan defined Adhesin_P1_N; Adhesin P1 N-terminal domain (PF18652; HMM-score: 15)Glyoxalase (CL0104) 3-dmu-9_3-mt; 3-demethylubiquinone-9 3-methyltransferase (PF06983; HMM-score: 14)Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 14)PFK (CL0240) Pfk_N; Phosphofructokinase N-terminal domain yeast (PF18468; HMM-score: 13)ZnExoPePases (CL0865) Peptidase_M42; M42 glutamyl aminopeptidase (PF05343; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9956
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0
- Extracellular Score: 0.0039
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002114
- TAT(Tat/SPI): 0.000315
- LIPO(Sec/SPII): 0.000431
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIQSMWFNLHVQDLEKSAQFYKALGFKINRNPQMLDKMVGIQIGQTTVILIENKHFQNVSQQSLNTEPNEVMISLGVNTNEEVDQLVNKVKEAGGTVVQEPTVSQGFYGAMFKDLDGHHFNFLVC
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e)