From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2532 [new locus tag: SAUSA300_RS14050 ]
  • pan locus tag?: SAUPAN006281000
  • symbol: panD
  • pan gene symbol?: panD
  • synonym:
  • product: aspartate alpha-decarboxylase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2532 [new locus tag: SAUSA300_RS14050 ]
  • symbol: panD
  • product: aspartate alpha-decarboxylase
  • replicon: chromosome
  • strand: -
  • coordinates: 2733670..2734041
  • length: 372
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGATGAATGCTAAAATTCATAGAGCAAGAGTGACTGAGTCAAATTTAAATTATGTAGGT
    AGCATTACGATTGATTCAGATATATTGGAAGCGGTAGACATCTTGCCAAATGAAAAAGTA
    GCCATCGTGAATAATAATAATGGTGCACGTTTTGAAACATACGTAATAGCTGGTGAAAGA
    GGTAGTGGTAAAATTTGTTTAAACGGTGCAGCGTCAAGACTTGTTGAAGTAGGCGATGTA
    GTCATAATCATGACTTATGCACAGTTGAATGAAGAAGAAATTAAAAACCATGCACCTAAA
    GTAGCAGTAATGAATGAAGATAATGTCATTATTGAAATGATTCATGAAAAAGAAAATACG
    ATAGTGTTATAA
    60
    120
    180
    240
    300
    360
    372

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_2532 [new locus tag: SAUSA300_RS14050 ]
  • symbol: PanD
  • description: aspartate alpha-decarboxylase
  • length: 123
  • theoretical pI: 4.6011
  • theoretical MW: 13548.4
  • GRAVY: -0.00731707

Function[edit | edit source]

  • reaction:
    EC 4.1.1.11?  ExPASy
    Aspartate 1-decarboxylase L-aspartate = beta-alanine + CO2
  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A aspartate 1-decarboxylase (TIGR00223; EC 4.1.1.11; HMM-score: 172.6)
    and 1 more
    crotonyl-CoA carboxylase/reductase (TIGR01751; EC 1.3.1.85; HMM-score: 16.9)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, Pigments Coenzyme A coA-FolK  Aspartate 1-decarboxylase (EC 4.1.1.11)
    and 3 more
    Coenzyme A Biosynthesis  Aspartate 1-decarboxylase (EC 4.1.1.11)
    dcernst CoA Salvage2  Aspartate 1-decarboxylase (EC 4.1.1.11)
    CoA Test  Aspartate 1-decarboxylase (EC 4.1.1.11)
  • PFAM:
    AcetylDC-like (CL0332) Asp_decarbox; Aspartate decarboxylase (PF02261; HMM-score: 169.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: pyruvate
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010013
    • TAT(Tat/SPI): 0.000263
    • LIPO(Sec/SPII): 0.00041
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MMNAKIHRARVTESNLNYVGSITIDSDILEAVDILPNEKVAIVNNNNGARFETYVIAGERGSGKICLNGAASRLVEVGDVVIIMTYAQLNEEEIKNHAPKVAVMNEDNVIIEMIHEKENTIVL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]