From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2562 [new locus tag: SAUSA300_RS15650 ]
  • pan locus tag?: SAUPAN006351000
  • symbol: SAUSA300_2562
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2562 [new locus tag: SAUSA300_RS15650 ]
  • symbol: SAUSA300_2562
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2772540..2772641
  • length: 102
  • essential: unknown

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    ATGAAAAAATTAGCAGTTATTTTAACATTAGTTGGCGGTTTATACTTCGCATTTAAAAAA
    TACCAAGAACGTGTTAACCAAGCACCTAACATTGAGTACTAA
    60
    102

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_2562 [new locus tag: SAUSA300_RS15650 ]
  • symbol: SAUSA300_2562
  • description: hypothetical protein
  • length: 33
  • theoretical pI: 10.0543
  • theoretical MW: 3846.56
  • GRAVY: 0.0484848

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • Doubtful CDS
  • PFAM:
    no clan defined DUF2648; Protein of unknown function (DUF2648) (PF10855; HMM-score: 63.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 5
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.370109
    • TAT(Tat/SPI): 0.005737
    • LIPO(Sec/SPII): 0.095273
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKKLAVILTLVGGLYFAFKKYQERVNQAPNIEY

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_2562&oldid=86223"