From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2599 [new locus tag: SAUSA300_RS14450 ]
  • pan locus tag?: SAUPAN006410000
  • symbol: tetR
  • pan gene symbol?: icaR
  • synonym:
  • product: intercellular adhesion operon transcription regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2599 [new locus tag: SAUSA300_RS14450 ]
  • symbol: tetR
  • product: intercellular adhesion operon transcription regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2825887..2826447
  • length: 561
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    TTGAAGGATAAGATTATTGATAACGCAATAACCTTATTTTCAGAGAAGGGGTATGACGGT
    ACAACACTTGATGATATAGCTAAAAGTGTAAATATAAAGAAAGCGAGTTTATATTACCAT
    TTTGACTCGAAAAAAAGTATTTACGAACAAAGTGTTAAATGTTGTTTTGATTACCTTAAT
    AATATTATTATGATGAATCAAAATAAATCGAACTATTCAATTGATGCTTTATATCAATTC
    TTATTTGAGTTTATTTTCGACATCGAAGAAAGGTATATTAGAATGTACGTTCAATTATCT
    AATACGCCTGAGGAATTTTCTGGAAATATTTACGGACAAATACAAGATTTAAATCAATCA
    TTAAGTAAAGAGATAGCAAAATTCTATGATGAATCAAAGATAAAGATGACAAAAGAAGAC
    TTTCAGAATTTAATATTGCTGTTTCTTGAAAGTTGGTATTTGAAAGCATCCTTTTCGCAA
    AAATTTGGAGCAGTGGAAGAAAGTAAAAGTCAATTCAAAGATGAAGTGTATTCGCTACTA
    AATATATTTTTGAAGAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    561

Protein[edit | edit source]

Protein Data Bank: 3GEU

General[edit | edit source]

  • locus tag: SAUSA300_2599 [new locus tag: SAUSA300_RS14450 ]
  • symbol: TetR
  • description: intercellular adhesion operon transcription regulator
  • length: 186
  • theoretical pI: 4.91883
  • theoretical MW: 21986.9
  • GRAVY: -0.376344

Function[edit | edit source]

  • TIGRFAM:
    pyrimidine utilization regulatory protein R (TIGR03613; HMM-score: 33.1)
    Signal transduction Regulatory functions DNA interactions mycofactocin system transcriptional regulator (TIGR03968; HMM-score: 32.8)
    and 1 more
    Signal transduction Regulatory functions DNA interactions transcriptional repressor BetI (TIGR03384; HMM-score: 26.3)
  • TheSEED:  
    Regulation and Cell signaling Quorum sensing and biofilm formation Biofilm formation in Staphylococcus  Biofilm operon icaABCD HTH-type negative transcriptional regulator IcaR
  • PFAM:
    HTH (CL0123) TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 59.1)
    and 2 more
    B-block_TFIIIC; B-block binding subunit of TFIIIC (PF04182; HMM-score: 15.8)
    HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 15)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • genes regulated by tetR*, TF important in Intercellular adhesionRegPrecise
    repression
    transcription units transferred from N315 data RegPrecise
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021785
    • TAT(Tat/SPI): 0.000661
    • LIPO(Sec/SPII): 0.003606
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKDKIIDNAITLFSEKGYDGTTLDDIAKSVNIKKASLYYHFDSKKSIYEQSVKCCFDYLNNIIMMNQNKSNYSIDALYQFLFEFIFDIEERYIRMYVQLSNTPEEFSGNIYGQIQDLNQSLSKEIAKFYDESKIKMTKEDFQNLILLFLESWYLKASFSQKFGAVEESKSQFKDEVYSLLNIFLKK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • tetR no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator: TetR* (repression) regulon
    TetR(TF)important in Intercellular adhesion; RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]