From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS00335 [old locus tag: SAUSA300_0066 ]
  • pan locus tag?: SAUPAN000815000
  • symbol: SAUSA300_RS00335
  • pan gene symbol?: argR
  • synonym:
  • product: ArgR family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS00335 [old locus tag: SAUSA300_0066 ]
  • symbol: SAUSA300_RS00335
  • product: ArgR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 74617..75063
  • length: 447
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (74617..75063) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAAAAGAAAAACGTTTAAATCTTATCTTAACTGTTATACAACAGAATCAGTTTAAT
    AAAAAACAACAAATAGTGGATTACATGGCAAGACATTTTGGAGTTTACTATAGCTTGACA
    ACTATTTCTCGTGACTTACAAGAATTAGAAATTTACAAAATCCCTGTTGAAAATAAAAAG
    TATATTTACAAGAAAATAAATCAAACAAATCAATTAAGTGCAAAAAAACAATTAGAAATA
    TTTAGTGATGAGATTATTGAATTTATAACGCTAAATAACTATGTCTTAATAAAAACATCT
    CCTGGCTTTGCTCAAAGTATAAGTTATTACATAGATCAATTACAAATGAAAGAAATATTA
    GGAATTATTGGAGGTAACGATACTTTGATGATTTTGACTTCTTCAAATGAAATAGCAGAA
    TTTGTTTGTTATCAATTATTCCCTTAA
    60
    120
    180
    240
    300
    360
    420
    447

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS00335 [old locus tag: SAUSA300_0066 ]
  • symbol: SAUSA300_RS00335
  • description: ArgR family transcriptional regulator
  • length: 148
  • theoretical pI: 8.84407
  • theoretical MW: 17390.1
  • GRAVY: -0.187838

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Amino acid biosynthesis Glutamate family arginine repressor (TIGR01529; HMM-score: 83.5)
    Signal transduction Regulatory functions DNA interactions arginine repressor (TIGR01529; HMM-score: 83.5)
  • TheSEED:
  • PFAM:
    no clan defined Arg_repressor_C; Arginine repressor, C-terminal domain (PF02863; HMM-score: 60.3)
    and 5 more
    HTH (CL0123) Arg_repressor; Arginine repressor, DNA binding domain (PF01316; HMM-score: 40.3)
    HTH_33; Winged helix-turn helix (PF13592; HMM-score: 14)
    no clan defined VPS9; Vacuolar sorting protein 9 (VPS9) domain (PF02204; HMM-score: 13.5)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 12.9)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004418
    • TAT(Tat/SPI): 0.000251
    • LIPO(Sec/SPII): 0.000682
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446634468 NCBI
  • RefSeq: WP_000711814 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKKEKRLNLILTVIQQNQFNKKQQIVDYMARHFGVYYSLTTISRDLQELEIYKIPVENKKYIYKKINQTNQLSAKKQLEIFSDEIIEFITLNNYVLIKTSPGFAQSISYYIDQLQMKEILGIIGGNDTLMILTSSNEIAEFVCYQLFP

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]