From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS00365 [old locus tag: SAUSA300_0072 ]
  • pan locus tag?: SAUPAN000820000
  • symbol: SAUSA300_RS00365
  • pan gene symbol?:
  • synonym:
  • product: methyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS00365 [old locus tag: SAUSA300_0072 ]
  • symbol: SAUSA300_RS00365
  • product: methyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 79705..80397
  • length: 693
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (79705..80397) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGACTAAGACTTATGACGTTTGGTGGCAAAAAGGTCAAGAATCAGATGATGATATGGCA
    CGAGACCATCAAGAAGCTTGGGAGAGAACAATAAAAATGCTTGATACATCTGACATCGAA
    GGGAAAACGATTTTAGATGTGGGATGTAATCAAGGCGGATTTTTACGACAGTTATACGAT
    ACAACACCGTTTAAAAAAGGTGTTGGCATAGATTTAGCACGTTTATCTTTGGAAAAGGCA
    GAGACATTAAAAGGACAACGTCCACTTACATACTATTTAACAGATAAACCGCAAGAAACG
    AAGCACGTGTTTGATACGGCAGTAAGTACGTCTGTCTTGTACTTAATAGAAGATATTCCG
    CAACATGCAAAAGATTTAAAAGAGGTATTGAAACCAGGCGGTGTTTATTACGCTTCATTC
    GCGGATTTAACTAATAACCCAAGTCGTCAGTTTATGGATGACACGATTAATCAATATGGT
    GCAACACCTTCTCAGAATCACTCTCTAAAACATATCGTTGATAGCTTTGTGGATGCAGGA
    TTTGAAGTTGCAGTAATGAAAGAGCATGTACCTGACGTGATTGATTTAACACATTATAGC
    GATTTTTATTTATCACCGAATGATTATTTACAAACACTATATGAAGAATCGTTTTTAATA
    AAAGCAAGTGTGAAAGAAGGTACTGAGAAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    693

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS00365 [old locus tag: SAUSA300_0072 ]
  • symbol: SAUSA300_RS00365
  • description: methyltransferase
  • length: 230
  • theoretical pI: 4.6315
  • theoretical MW: 26232.2
  • GRAVY: -0.571304

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 35.4)
    Unknown function Enzymes of unknown specificity tRNA (mo5U34)-methyltransferase (TIGR00452; EC 2.1.1.-; HMM-score: 30.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 30.8)
    and 10 more
    Genetic information processing Transcription RNA processing 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 20.1)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 3' terminal RNA ribose 2'-O-methyltransferase Hen1 (TIGR04074; EC 2.1.1.-; HMM-score: 20.1)
    2-ketoarginine methyltransferase (TIGR04543; EC 2.1.1.243; HMM-score: 19.8)
    pseudaminic acid biosynthesis-associated methylase (TIGR03587; HMM-score: 18.8)
    methyltransferase, Rta_06860 family (TIGR04290; EC 2.1.1.-; HMM-score: 18.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 18.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 18.1)
    Metabolism Amino acid biosynthesis Aspartate family methionine biosynthesis protein MetW (TIGR02081; HMM-score: 14)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 12.1)
    Unknown function General TlyA family rRNA methyltransferase/putative hemolysin (TIGR00478; HMM-score: 11.3)
  • TheSEED:
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 49)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 41.2)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 39.2)
    and 9 more
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 37.6)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 33.3)
    Methyltransf_9; Protein of unknown function (DUF1698) (PF08003; HMM-score: 28.1)
    NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 20.8)
    FtsJ; FtsJ-like methyltransferase (PF01728; HMM-score: 13.3)
    Uteroglobin (CL0370) Feld-I_B; Allergen Fel d I-B chain (PF09252; HMM-score: 12.8)
    NADP_Rossmann (CL0063) Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 12.2)
    CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 12)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 11.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.020523
    • TAT(Tat/SPI): 0.000511
    • LIPO(Sec/SPII): 0.001954
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446091729 NCBI
  • RefSeq: WP_000169584 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MTKTYDVWWQKGQESDDDMARDHQEAWERTIKMLDTSDIEGKTILDVGCNQGGFLRQLYDTTPFKKGVGIDLARLSLEKAETLKGQRPLTYYLTDKPQETKHVFDTAVSTSVLYLIEDIPQHAKDLKEVLKPGGVYYASFADLTNNPSRQFMDDTINQYGATPSQNHSLKHIVDSFVDAGFEVAVMKEHVPDVIDLTHYSDFYLSPNDYLQTLYEESFLIKASVKEGTEK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]