Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS00390 [old locus tag: SAUSA300_0077 ]
- pan locus tag?: SAUPAN000825000
- symbol: SAUSA300_RS00390
- pan gene symbol?: —
- synonym:
- product: NAD+ synthetase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS00390 [old locus tag: SAUSA300_0077 ]
- symbol: SAUSA300_RS00390
- product: NAD+ synthetase
- replicon: chromosome
- strand: +
- coordinates: 84400..85035
- length: 636
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (84400..85035) NCBI
- BioCyc: SAUSA300_RS00390 BioCyc
- MicrobesOnline: see SAUSA300_0077
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGCTTAAAATAGAGAGATTAACCAAATATATAGACACGCAACTGATATTTAAAGAGATA
TCATGTACAATTAACGACCAGCACTTACTCATAAGTGGGGAGAGTGGTTGTGGTAAATCC
ACATTAGCCAAGATTATCGCTGGCTTAGATACGGATTATCAGGGCGAATTATATCTTAAT
GGGCGCTTACGTGAATCTTATACGTCTAAAGAGTGGATGAAGCACATCCAATATGTACCT
CAATATCAACGTGATACTTTAAATCAGCGTAAAACGGTATTAGCTACATTATTAGAACCA
CTTAAGAATTATAAGGTAAATAAACAGCGTTATACATCAAGCATTGAAGCAGTGCTTGAT
CAGTGTAATTTACCACACGATATACTTAATCATAAAGTTTCGACATTAAGTGGTGGCCAA
TTTCAACGCGTCTGGATAGCTAAAGCTTTAATATTAGAACCAGAGATTCTCATATTGGAT
GAAGCTACAACCAACTTAGATGTCATTAATGAAGAAGCTATACTTCAAATGTTGATTTCC
TTAAAGATGACACAATTAATCATTATTTCACATGATACATACGTCTTAAGCCAATTTGAA
GGAATTCAGTTACAGCTAAATAAATTGAATAATTAA60
120
180
240
300
360
420
480
540
600
636
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS00390 [old locus tag: SAUSA300_0077 ]
- symbol: SAUSA300_RS00390
- description: NAD+ synthetase
- length: 211
- theoretical pI: 6.67406
- theoretical MW: 24236.9
- GRAVY: -0.190995
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 126.7)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 122.1)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 122.1)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 103.9)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 102.7)and 70 moreCellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 99.4)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 94.5)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 92.7)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 92.4)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 89.4)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 86.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 86.3)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 83.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 83.5)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 79.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 79.6)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 79.4)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 78.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 78.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 78.4)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 78.2)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 78)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 78)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 77.2)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 76.4)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 76)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 76)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 74.8)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 74)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 71.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 71.4)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 70.7)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 70.4)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 69.8)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 69.4)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 68.5)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 67.3)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 67)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 67)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 65.7)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 65.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 62.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 62)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 62)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 61.4)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 60.7)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 60.7)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 59.8)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 58.6)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 58.4)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 57.5)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 56.4)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 55.6)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 54.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 53)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 52.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 52.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 48)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 43.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 38.4)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 38.3)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 35)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 35)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 33.7)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 30)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 29.8)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 25.4)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 24.8)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 17.1)DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 13.6)HprK-related kinase B (TIGR04355; HMM-score: 11.9)Protein fate Protein and peptide secretion and trafficking type VII secretion protein EccCb (TIGR03925; HMM-score: 11.3)
- TheSEED: see SAUSA300_0077
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 99.5)and 22 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 31.2)AAA_22; AAA domain (PF13401; HMM-score: 26.4)AAA_16; AAA ATPase domain (PF13191; HMM-score: 20.7)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 18.1)Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 18)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 17.1)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 17)RNA_helicase; RNA helicase (PF00910; HMM-score: 16.7)AAA_23; AAA domain (PF13476; HMM-score: 16.7)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 16.3)Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 16.2)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 15.8)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 15.7)DUF87; Domain of unknown function DUF87 (PF01935; HMM-score: 14.7)AAA_10; AAA-like domain (PF12846; HMM-score: 14.7)AAA_18; AAA domain (PF13238; HMM-score: 14.3)PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 13.6)NACHT; NACHT domain (PF05729; HMM-score: 13.3)RuvB_N; Holliday junction DNA helicase ruvB N-terminus (PF05496; HMM-score: 13.2)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.1)IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 12.7)SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.02422
- TAT(Tat/SPI): 0.000626
- LIPO(Sec/SPII): 0.014705
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446835068 NCBI
- RefSeq: WP_000912324 NCBI
- UniProt: see SAUSA300_0077
⊟Protein sequence[edit | edit source]
- MLKIERLTKYIDTQLIFKEISCTINDQHLLISGESGCGKSTLAKIIAGLDTDYQGELYLNGRLRESYTSKEWMKHIQYVPQYQRDTLNQRKTVLATLLEPLKNYKVNKQRYTSSIEAVLDQCNLPHDILNHKVSTLSGGQFQRVWIAKALILEPEILILDEATTNLDVINEEAILQMLISLKMTQLIIISHDTYVLSQFEGIQLQLNKLNN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.