PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_0077 [new locus tag: SAUSA300_RS00390 ]
• pan locus tag^?: SAUPAN000825000
• symbol: SAUSA300_0077
• pan gene symbol^?: —
• synonym:
• product: ABC transporter ATP-binding protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_0077 [new locus tag: SAUSA300_RS00390 ]
• symbol: SAUSA300_0077
• product: ABC transporter ATP-binding protein
• replicon: chromosome
• strand: +
• coordinates: 84400..85035
• length: 636
• essential: unknown

⊟Accession numbers

• Gene ID: 3913108 NCBI
• RefSeq: YP_492795 NCBI
• BioCyc: see SAUSA300_RS00390
• MicrobesOnline: 1291592 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  421
  481
  541
  601
  
  ATGCTTAAAATAGAGAGATTAACCAAATATATAGACACGCAACTGATATTTAAAGAGATA
  TCATGTACAATTAACGACCAGCACTTACTCATAAGTGGGGAGAGTGGTTGTGGTAAATCC
  ACATTAGCCAAGATTATCGCTGGCTTAGATACGGATTATCAGGGCGAATTATATCTTAAT
  GGGCGCTTACGTGAATCTTATACGTCTAAAGAGTGGATGAAGCACATCCAATATGTACCT
  CAATATCAACGTGATACTTTAAATCAGCGTAAAACGGTATTAGCTACATTATTAGAACCA
  CTTAAGAATTATAAGGTAAATAAACAGCGTTATACATCAAGCATTGAAGCAGTGCTTGAT
  CAGTGTAATTTACCACACGATATACTTAATCATAAAGTTTCGACATTAAGTGGTGGCCAA
  TTTCAACGCGTCTGGATAGCTAAAGCTTTAATATTAGAACCAGAGATTCTCATATTGGAT
  GAAGCTACAACCAACTTAGATGTCATTAATGAAGAAGCTATACTTCAAATGTTGATTTCC
  TTAAAGATGACACAATTAATCATTATTTCACATGATACATACGTCTTAAGCCAATTTGAA
  GGAATTCAGTTACAGCTAAATAAATTGAATAATTAA
  60
  120
  180
  240
  300
  360
  420
  480
  540
  600
  636
  

⊟Protein

⊟General

• locus tag: SAUSA300_0077 [new locus tag: SAUSA300_RS00390 ]
• symbol: SAUSA300_0077
• description: ABC transporter ATP-binding protein
• length: 211
• theoretical pI: 6.67406
• theoretical MW: 24236.9
• GRAVY: -0.190995

⊟Function

• TIGRFAM:
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 126.7)
  Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 122.1)
  Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 122.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 103.9)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 102.7)
  and 70 more
  Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 99.4)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 94.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 92.7)
  thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 92.4)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)
  Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)
  Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 89.4)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 86.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 86.3)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 83.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 83.5)
  Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 79.8)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 79.6)
  Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 79.4)
  Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 78.6)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 78.6)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 78.4)
  thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 78.2)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 78)
  Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 78)
  ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 77.2)
  Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 76.4)
  Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 76)
  proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 76)
  ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 74.8)
  Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 74)
  lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 71.5)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 71.4)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 70.7)
  Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 70.4)
  gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 69.8)
  phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 69.4)
  Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 68.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 67.3)
  Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 67)
  Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 67)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 65.7)
  Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 65.7)
  Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 62.8)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 62)
  Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 62)
  D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 61.4)
  Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 60.7)
  Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 60.7)
  Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 59.8)
  Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 58.6)
  ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 58.4)
  Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 57.5)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 56.4)
  Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 55.6)
  2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 54.3)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 53)
  ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 52.7)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 52.3)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 48)
  Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 43.2)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 38.4)
  Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 38.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 35)
  Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 35)
  Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 33.7)
  Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 30)
  Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 29.8)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 25.4)
  Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 24.8)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 17.1)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 13.6)
  HprK-related kinase B (TIGR04355; HMM-score: 11.9)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EccCb (TIGR03925; HMM-score: 11.3)
• TheSEED  :
  • Nickel transport ATP-binding protein NikE (TC 3.A.1.5.3)
  Membrane Transport Membrane Transport - no subcategory Transport of Nickel and Cobalt  Nickel transport ATP-binding protein NikE (TC 3.A.1.5.3)
• PFAM:
  P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 99.5)
  and 22 more
  SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 31.2)
  AAA_22; AAA domain (PF13401; HMM-score: 26.4)
  AAA_16; AAA ATPase domain (PF13191; HMM-score: 20.7)
  RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 18.1)
  Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 18)
  AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 17.1)
  AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 17)
  RNA_helicase; RNA helicase (PF00910; HMM-score: 16.7)
  AAA_23; AAA domain (PF13476; HMM-score: 16.7)
  Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 16.3)
  Sigma54_activat; Sigma-54 interaction domain (PF00158; HMM-score: 16.2)
  AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 15.8)
  AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 15.7)
  DUF87; Domain of unknown function DUF87 (PF01935; HMM-score: 14.7)
  AAA_10; AAA-like domain (PF12846; HMM-score: 14.7)
  AAA_18; AAA domain (PF13238; HMM-score: 14.3)
  PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 13.6)
  NACHT; NACHT domain (PF05729; HMM-score: 13.3)
  RuvB_N; Holliday junction DNA helicase ruvB N-terminus (PF05496; HMM-score: 13.2)
  ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.1)
  IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 12.7)
  SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 12.2)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 1.05
  • Cytoplasmic Membrane Score: 8.78
  • Cellwall Score: 0.08
  • Extracellular Score: 0.09
  • Internal Helices: 0
• LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: -1
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.02422
  • TAT(Tat/SPI): 0.000626
  • LIPO(Sec/SPII): 0.014705
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 87162114 NCBI
• RefSeq: YP_492795 NCBI
• UniProt: A0A0H2XIH8 UniProt

⊟Protein sequence

• MLKIERLTKYIDTQLIFKEISCTINDQHLLISGESGCGKSTLAKIIAGLDTDYQGELYLNGRLRESYTSKEWMKHIQYVPQYQRDTLNQRKTVLATLLEPLKNYKVNKQRYTSSIEAVLDQCNLPHDILNHKVSTLSGGQFQRVWIAKALILEPEILILDEATTNLDVINEEAILQMLISLKMTQLIIISHDTYVLSQFEGIQLQLNKLNN

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SAUSA300_0072 > SAUSA300_0073 > opp-3B > opp-3C > SAUSA300_0076 > SAUSA300_0077

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications