From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS00430 [old locus tag: SAUSA300_0083 ]
  • pan locus tag?: SAUPAN000489000
  • symbol: SAUSA300_RS00430
  • pan gene symbol?: tauE
  • synonym:
  • product: anion permease

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS00430 [old locus tag: SAUSA300_0083 ]
  • symbol: SAUSA300_RS00430
  • product: anion permease
  • replicon: chromosome
  • strand: -
  • coordinates: 91958..92713
  • length: 756
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (91958..92713) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGGATATTGTTAATATAGTTATCATGTTACTCATTGGGGTATTCGGTGGGTTCATATCT
    GGTCTAGTAGGCGTAGGTGGTGCTATCATTATTTATCCAGCTATTTTATTATTACCACCA
    TTATTCGGAGCCCCTGCATATAGCGCATATATCGCATCAGGTCTTACTTCTAGCCAAGTC
    TTTTTCAGTACATTAAGTGGCTCATTAAAAGCTCGAAAAAAAACAGAGTTCTCGCCACAA
    TTAGTTCTTTATATGGGTGGCGGCATGATTATAGGGAGTATGTTAGGTGCATTTCTAGCA
    AATTTATTTGATGCTACATTTGTAAATACGGTATATATCATTATTGCTTTACTTGCATTA
    ACATTAATGTTTATTAAAGTGAAACCTAGTTCCGAAAAGTCTTCATTTAATAAATATTTA
    TTAGTTATCATTGGCCTTTTCATTGGTATTATTTCAGGTATAGTAGGTGCAGGTGGTGCC
    TTCATTATTATTCCTATATTATTGGTTTTATTCAAATTACCAATGAATACTGTAGTCGCT
    AATAGTATAGTAATTGCTTTTATATCTTCAATTGGTGCTTTTGTCATCAAACTTATTCAA
    GGTTATATCCCTTTATATGACGCCTTATTCCTTATAATAGGGAGTATTATATTTGCTCCA
    ATAGGGTTAAAATTAAGTAAAAAAGTCCCTAACATAATACAAAAATGGATTATCAGTATT
    TTAATCGTTTTTGCTATAGTTCAACTCATTTTATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    756

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS00430 [old locus tag: SAUSA300_0083 ]
  • symbol: SAUSA300_RS00430
  • description: anion permease
  • length: 251
  • theoretical pI: 10.2985
  • theoretical MW: 26690.6
  • GRAVY: 1.3992

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    LysE (CL0292) TauE; Sulfite exporter TauE/SafE (PF01925; HMM-score: 140.8)
    and 1 more
    no clan defined DUF3488; Domain of unknown function (DUF3488) (PF11992; HMM-score: 6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 8
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.054892
    • TAT(Tat/SPI): 0.009404
    • LIPO(Sec/SPII): 0.016165
  • predicted transmembrane helices (TMHMM): 7

Accession numbers[edit | edit source]

  • GI: 446277990 NCBI
  • RefSeq: WP_000355845 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MDIVNIVIMLLIGVFGGFISGLVGVGGAIIIYPAILLLPPLFGAPAYSAYIASGLTSSQVFFSTLSGSLKARKKTEFSPQLVLYMGGGMIIGSMLGAFLANLFDATFVNTVYIIIALLALTLMFIKVKPSSEKSSFNKYLLVIIGLFIGIISGIVGAGGAFIIIPILLVLFKLPMNTVVANSIVIAFISSIGAFVIKLIQGYIPLYDALFLIIGSIIFAPIGLKLSKKVPNIIQKWIISILIVFAIVQLIL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]