Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS00455 [old locus tag: SAUSA300_0088 ]
- pan locus tag?: SAUPAN000751000
- symbol: SAUSA300_RS00455
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS00455 [old locus tag: SAUSA300_0088 ]
- symbol: SAUSA300_RS00455
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 97021..97122
- length: 102
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (97021..97122) NCBI
- BioCyc: see SAUSA300_0088
- MicrobesOnline: see SAUSA300_0088
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61TTGAGTACACGTGGTTTGAATATCTGGCAAGAAATGGAAATTGGTAATGTCAGTCATAAA
GTCGCTAAACGTGCTCAAATACCATTAATTATTTTTAAATAA60
102
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS00455 [old locus tag: SAUSA300_0088 ]
- symbol: SAUSA300_RS00455
- description: hypothetical protein
- length: 33
- theoretical pI: 11.0585
- theoretical MW: 3809.53
- GRAVY: -0.0545455
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_0088
- PFAM: HUP (CL0039) Usp; Universal stress protein family (PF00582; HMM-score: 15.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.091779
- TAT(Tat/SPI): 0.019166
- LIPO(Sec/SPII): 0.041383
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 487706005 NCBI
- RefSeq: WP_001790237 NCBI
- UniProt: see SAUSA300_0088
⊟Protein sequence[edit | edit source]
- MSTRGLNIWQEMEIGNVSHKVAKRAQIPLIIFK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]