From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS01560 [old locus tag: SAUSA300_0292 ]
  • pan locus tag?: SAUPAN001197000
  • symbol: SAUSA300_RS01560
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS01560 [old locus tag: SAUSA300_0292 ]
  • symbol: SAUSA300_RS01560
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 346291..346509
  • length: 219
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGAAAACCAAAAACAAGGCAATGGCTTAAAAATTGCAACATGGGTATTTATTGTATTA
    ACAGTAGTTACACCGCTATTTGGTATTGGAAGTATTGTTTGTAGTATTAATTATAAAAAA
    TACGATGCTGAAAAAGGTTCGAAGTTATTGCAAATTGCAATTATCGTAACAATAATTGCT
    TTTGTTTTAAATTTATTAGCATATTTAGGTTTAAGATAA
    60
    120
    180
    219

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS01560 [old locus tag: SAUSA300_0292 ]
  • symbol: SAUSA300_RS01560
  • description: hypothetical protein
  • length: 72
  • theoretical pI: 9.97598
  • theoretical MW: 7926.51
  • GRAVY: 0.795833

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAUSA300_0292
  • PFAM:
    no clan defined AWPM-19; AWPM-19-like family (PF05512; HMM-score: 18.5)
    DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 17.8)
    and 4 more
    DUF6526; Family of unknown function (DUF6526) (PF20136; HMM-score: 14.6)
    Transporter (CL0375) SUR7; SUR7/PalI family (PF06687; HMM-score: 14.1)
    C_Lectin (CL0056) Chordopox_A33R; Chordopoxvirus A33R protein (PF05966; HMM-score: 12.1)
    no clan defined DUF6548; Family of unknown function (DUF6548) (PF20185; HMM-score: 10.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.666
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.3336
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.026764
    • TAT(Tat/SPI): 0.000431
    • LIPO(Sec/SPII): 0.187649
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEKGSKLLQIAIIVTIIAFVLNLLAYLGLR

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_RS01560&oldid=77235"