From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS01905 [old locus tag: SAUSA300_0359 ]
  • pan locus tag?: SAUPAN001902000
  • symbol: SAUSA300_RS01905
  • pan gene symbol?: metC
  • synonym:
  • product: cystathionine beta-lyase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS01905 [old locus tag: SAUSA300_0359 ]
  • symbol: SAUSA300_RS01905
  • product: cystathionine beta-lyase
  • replicon: chromosome
  • strand: -
  • coordinates: 412103..413263
  • length: 1161
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (412103..413263) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGACACTTTCAAAAGAGACAGAAGTGATATTCGATTGGCGTAGAGGTGTGGAATATCAT
    TCAGCTAACCCACCACTCTATGATTCTTCAACATTCCATCAAACAAGTCTTGGTGGCGAT
    GTTAAATATGATTATGCACGAAGTGGCAACCCTAACCGTGAACTTTTAGAAGAGAAGTTA
    GCACGATTAGAACAGGGAAAATTCGCTTTTGCTTTTGCATCAGGTATTGCTGCTATTTCA
    GCAGTACTTTTGACTTTCAAATCTGGTGATCATGTCATCTTACCCGATGATGTATATGGC
    GGTACTTTTCGCCTCACTGAGCAAATTTTGAATCGATTTAATATTGAATTTACAACCGTA
    GATACTACAAAGCTCGAACAAATCGAGGGTGCCATTCAATCAAACACAAAATTAATTTAT
    ATCGAAACACCATCGAATCCCTGTTTTAAAATTACTGATATCAAAGCTGTTTCTAAAATA
    GCCGAAAAGCATGAACTACTGGTAGCTGTGGACAATACATTTATGACACCGTTAGGTCAA
    TCACCTTTATTACTTGGCGCTGATATTGTCATTCATAGTGCTACAAAATTTTTAAGTGGA
    CATAGCGATTTAATTGCTGGTGCTGTCATAACTAATAATGAGGCAATTAGTGACGCTCTT
    TATTTAATACAAAATGGTACAGGCAATATGTTATCTGCTCAGGATAGCTGGACACTTGCT
    AAACATTTAAAAACTTTTCCAATCAGATTTAAACAATCTGTCGAAAACGCTCAAAAAATC
    GTGTCATTTTTAATAAAGCAAGATGAAATTTCAGAAGTTTATTATCCGGGACTCACTACT
    GCTCATTTAGAACAAGCTAAAAATGGCGGTGCCGTTATTGGCTTTCGTTTAGCTGATGAG
    TCTAAAGCACAACAATTTGTCGATGCACTGACATTACCACTCGTTTCAGTGAGTCTGGGC
    GGTGTTGAAACGATCCTTTCACATCCAGCAACAATGTCTCACGCTGCACTACCTGAAGAA
    GTGAGACAAGAACGTGGTATCACTTTCGGTCTATTCCGATTAAGTGTTGGTCTCGAAGAT
    CCTGATGAACTCATTGCAGACATCAAATACGCATTAAAGGAGGCATTCAATGAGTCAATT
    CCTCACACAATTGAAAGATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1161

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS01905 [old locus tag: SAUSA300_0359 ]
  • symbol: SAUSA300_RS01905
  • description: cystathionine beta-lyase
  • length: 386
  • theoretical pI: 5.04033
  • theoretical MW: 42487.9
  • GRAVY: -0.0761658

Function[edit | edit source]

  • TIGRFAM:
    cystathionine beta-lyase (TIGR01329; EC 4.4.1.8; HMM-score: 356)
    Metabolism Amino acid biosynthesis Aspartate family O-succinylhomoserine (thiol)-lyase (TIGR02080; EC 2.5.1.48; HMM-score: 345.5)
    Metabolism Energy metabolism Amino acids and amines methionine gamma-lyase (TIGR01328; EC 4.4.1.11; HMM-score: 335.9)
    Metabolism Amino acid biosynthesis Aspartate family O-succinylhomoserine sulfhydrylase (TIGR01325; EC 4.2.99.-; HMM-score: 294.6)
    and 26 more
    Metabolism Amino acid biosynthesis Aspartate family O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 266.1)
    Metabolism Amino acid biosynthesis Serine family O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 266.1)
    Metabolism Amino acid biosynthesis Aspartate family cystathionine beta-lyase (TIGR01324; EC 4.4.1.8; HMM-score: 202.2)
    Unknown function Enzymes of unknown specificity cysteine desulfurase family protein (TIGR01977; HMM-score: 24.8)
    Metabolism Amino acid biosynthesis Histidine family histidinol-phosphate transaminase (TIGR01141; EC 2.6.1.9; HMM-score: 23.4)
    Unknown function Enzymes of unknown specificity cysteine desulfurase family protein (TIGR01976; HMM-score: 21.9)
    tyrosine/nicotianamine family aminotransferase (TIGR01265; HMM-score: 21.5)
    LL-diaminopimelate aminotransferase (TIGR03540; EC 2.6.1.83; HMM-score: 19.7)
    Unknown function Enzymes of unknown specificity uncharacterized pyridoxal phosphate-dependent enzyme (TIGR01437; HMM-score: 19.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin 8-amino-7-oxononanoate synthase (TIGR00858; EC 2.3.1.47; HMM-score: 18.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin threonine-phosphate decarboxylase (TIGR01140; EC 4.1.1.81; HMM-score: 18.7)
    Metabolism Energy metabolism Amino acids and amines tyrosine aminotransferase (TIGR01264; EC 2.6.1.5; HMM-score: 18.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other cysteine desulfurase, SufS family (TIGR01979; HMM-score: 18.6)
    succinyldiaminopimelate transaminase (TIGR03539; EC 2.6.1.17; HMM-score: 18.4)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides TDP-4-keto-6-deoxy-D-glucose transaminase (TIGR02379; HMM-score: 17.3)
    putative C-S lyase (TIGR04350; EC 4.4.-.-; HMM-score: 15.6)
    Metabolism Energy metabolism Amino acids and amines glycine dehydrogenase (TIGR00461; EC 1.4.4.2; HMM-score: 13.4)
    succinyldiaminopimelate transaminase (TIGR03538; EC 2.6.1.17; HMM-score: 13.2)
    Cellular processes Cellular processes Biosynthesis of natural products capreomycidine synthase (TIGR03947; HMM-score: 13.2)
    Genetic information processing Protein synthesis tRNA and rRNA base modification cysteine desulfurase IscS (TIGR02006; EC 2.8.1.7; HMM-score: 12.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other cysteine desulfurase IscS (TIGR02006; EC 2.8.1.7; HMM-score: 12.9)
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine transaminase (TIGR03588; EC 2.6.1.92; HMM-score: 12.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin 5-aminolevulinic acid synthase (TIGR01821; EC 2.3.1.37; HMM-score: 12.3)
    putative pyridoxal phosphate-dependent acyltransferase (TIGR01825; EC 2.3.1.-; HMM-score: 12.2)
    beta-methylarginine biosynthesis bifunctional aminotransferase (TIGR04544; EC 2.6.-.-; HMM-score: 11.5)
    succinyldiaminopimelate transaminase (TIGR03537; EC 2.6.1.17; HMM-score: 11.2)
  • TheSEED:
  • PFAM:
    PLP_aminotran (CL0061) Cys_Met_Meta_PP; Cys/Met metabolism PLP-dependent enzyme (PF01053; HMM-score: 417.5)
    and 7 more
    Aminotran_1_2; Aminotransferase class I and II (PF00155; HMM-score: 34)
    DegT_DnrJ_EryC1; DegT/DnrJ/EryC1/StrS aminotransferase family (PF01041; HMM-score: 31.3)
    Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 24)
    Met_gamma_lyase; Methionine gamma-lyase (PF06838; HMM-score: 23.5)
    SelA; L-seryl-tRNA selenium transferase (PF03841; HMM-score: 15)
    Beta_elim_lyase; Beta-eliminating lyase (PF01212; HMM-score: 12.8)
    GG-leader (CL0400) ComC; COMC family (PF03047; HMM-score: 10.3)

Structure, modifications & interactions[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009234
    • TAT(Tat/SPI): 0.001149
    • LIPO(Sec/SPII): 0.002636
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446097991 NCBI
  • RefSeq: WP_000175846 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MTLSKETEVIFDWRRGVEYHSANPPLYDSSTFHQTSLGGDVKYDYARSGNPNRELLEEKLARLEQGKFAFAFASGIAAISAVLLTFKSGDHVILPDDVYGGTFRLTEQILNRFNIEFTTVDTTKLEQIEGAIQSNTKLIYIETPSNPCFKITDIKAVSKIAEKHELLVAVDNTFMTPLGQSPLLLGADIVIHSATKFLSGHSDLIAGAVITNNEAISDALYLIQNGTGNMLSAQDSWTLAKHLKTFPIRFKQSVENAQKIVSFLIKQDEISEVYYPGLTTAHLEQAKNGGAVIGFRLADESKAQQFVDALTLPLVSVSLGGVETILSHPATMSHAALPEEVRQERGITFGLFRLSVGLEDPDELIADIKYALKEAFNESIPHTIER

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]