From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS03260 [old locus tag: SAUSA300_0607 ]
  • pan locus tag?: SAUPAN002490000
  • symbol: SAUSA300_RS03260
  • pan gene symbol?: sroB
  • synonym:
  • product: DUF2922 domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS03260 [old locus tag: SAUSA300_0607 ]
  • symbol: SAUSA300_RS03260
  • product: DUF2922 domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 680952..681176
  • length: 225
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGACTAAAACACTTGAATTAAGTTTTAAATCTTCACTAGACAAGCCTGTAAAACTGCAA
    TTACCACAATTAAACAACGTAGTGACCGAGCAAGTTGCACGTGATAGTATGAATGCATTA
    GTAGATTTAAATATTATAAAGTCAAATAGTGGTACTATCACCAAAGTACATTCTGCTCAA
    ATTATTGATAAAACAACAACTGTTTTATTTGAAGATAAGAAATAG
    60
    120
    180
    225

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS03260 [old locus tag: SAUSA300_0607 ]
  • symbol: SAUSA300_RS03260
  • description: DUF2922 domain-containing protein
  • length: 74
  • theoretical pI: 9.91781
  • theoretical MW: 8228.49
  • GRAVY: -0.218919

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAUSA300_0607
  • PFAM:
    no clan defined DUF2922; Protein of unknown function (DUF2922) (PF11148; HMM-score: 69.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.1752
    • Cytoplasmic Membrane Score: 0.0347
    • Cell wall & surface Score: 0.0189
    • Extracellular Score: 0.7712
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009545
    • TAT(Tat/SPI): 0.000333
    • LIPO(Sec/SPII): 0.000361
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTKTLELSFKSSLDKPVKLQLPQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]