⊟Summary[edit | edit source]
- pan ID?: SAUPAN002490000
- symbol?: sroB
- synonym:
- description?: DUF2922 domain-containing protein
- DUF2922 domain-containing protein
- pseudogene
descriptions from strain specific annotations:
- strand?: -
- coordinates?: 3004874..3005098
- synteny block?: BlockID0017260
- occurrence?: in 100% of 34 strains
sroB : sigS antisense RNA (s750)-stimulating protein SroB [1]
Staphylococci need to calibrate the levels of their extracytoplasmic function sigma factor SigS in response to environmental signals. One mechanism for posttranscriptional SigS regulation is the SroAB system. As a small operon that is part of the SigS regulon, SroA and SroB bind to and sequester each other, each effectively negating the effect of the other. However, when released, SroA stabilizes sigS mRNA transcripts, ultimately resulting in increased SigS levels whereas free SroB increases expression of s750, a sigS-targeting antisense RNA. How SroB enhances transcription of s750 antisense RNA, how the SroAB complex dissociates and how only one of either the SigS-activating SroA or the SigS-repressing SroB is released in a functional form remains to be defined.
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
COL | |
N315 | |
NCTC8325 | |
Newman | |
USA300_FPR3757 |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.307)
COL ---------------------------------------MTKTLELSFKSSLDKPVKLQL
N315 ---------------------------------------MTKTLELSFKSSLDKPVKLQL
NCTC8325 ---------------------------------------MTKTLELSFKSSLDKPVKLQL
Newman MHQTTKLKHSANLLSDLLEKHIAISNSSNLYQFNQEDIFMTKTLELSFKSSLDKPVKLQL
USA300_FPR3757 ---------------------------------------MTKTLELSFKSSLDKPVKLQL
*********************
COL PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
N315 PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
NCTC8325 PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
Newman PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
USA300_FPR3757 PQLNNVVTEQVARDSMNALVDLNIIKSNSGTITKVHSAQIIDKTTTVLFEDKK
*****************************************************
- ↑ Amer Al Ali, Jamilah Alsulami, Joseph I Aubee, Ayotimofe Idowu, Brooke R Tomlinson, Emily A Felton, Jessica K Jackson, Sarah J Kennedy, Nathanial J Torres, Lindsey N Shaw, Karl M Thompson
Staphylococcus aureus SigS Induces Expression of a Regulatory Protein Pair That Modulates Its mRNA Stability.
J Bacteriol: 2023, 205(6);e0039222
[PubMed:37255480] [WorldCat.org] [DOI] (I p)