Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS03795 [old locus tag: SAUSA300_0706 ]
- pan locus tag?: SAUPAN002609000
- symbol: SAUSA300_RS03795
- pan gene symbol?: opuBA
- synonym:
- product: glycine/betaine ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS03795 [old locus tag: SAUSA300_0706 ]
- symbol: SAUSA300_RS03795
- product: glycine/betaine ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 783254..784231
- length: 978
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (783254..784231) NCBI
- BioCyc: SAUSA300_RS03795 BioCyc
- MicrobesOnline: see SAUSA300_0706
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961GTGATTAAGTTTAAAAATGTAACTAAGCGTTATGGCAAACATGTTGCTGTCGATAACATT
AGTTTCAATATTAATGAGGGTGAATTTTTTGTGCTAATTGGACCTTCAGGTTGTGGAAAA
ACTACGACATTAAAAATGATTAATCGACTCATTCACTTAAGTGAAGGTTATATTTATTTT
AAAGATAAACCAATAAGTGATTATCCAGTATACGAAATGCGTTGGGATATTGGATACGTA
TTGCAGCAGATTGCATTATTCCCACATATGACAATCAAAGAAAATATTGCACAAGTGCCA
CAAATGAAAAAGTGGAAAGAAAAAGATATAGATAAAAGAGTAGATGAATTACTTGAAATG
GTTGGATTAGAACCTGAAAAATATAAAAACAGAAAACCTGATGAATTGTCAGGGGGGCAA
CGACAACGTGTAGGAGTTATACGTGCGTTAGCAGCTGATCCACCAGTTATTTTAATGGAT
GAACCGTTTAGTGCATTAGACCCAATCAGCCGAGAAAAACTTCAAGATGATTTAATTGAA
TTACAAACTAAAATTAAGAAGACAATCATATTTGTTACACATGATATTCAAGAGGCGATG
AAACTTGGTGATAAGATTTGTCTTTTGAATGAAGGGCATATTGAACAAATTGACACACCA
GAAGGATTTAAAAATAATCCTCAAAGTGAATTTGTTAAACAATTTATGGGTAGTCATTTA
GAAGATGATGCGCCATGTGTTGAAGAGAACGCAATTATCCGTGACTTGGATATTATGAAA
CCAATCGATGAGGTTACATCTATGAGCGCTTATCCAATTGTTTATGACAATCAACCAATT
GAAGTATTGTATCAACTTTTATCAGAGAGCGAGCGTGTCATTGTCATGCAAGAAGATAGC
GTAGGTCAATATGTTATTGATAGGAAAGATATCTTCAAATATTTGTCCCAGAAAAAGGAG
GTAGCTCAACATGACTAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
960
978
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS03795 [old locus tag: SAUSA300_0706 ]
- symbol: SAUSA300_RS03795
- description: glycine/betaine ABC transporter ATP-binding protein
- length: 325
- theoretical pI: 4.98801
- theoretical MW: 37538
- GRAVY: -0.405538
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 306.3)and 74 moreTransport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 244.7)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 241.6)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 232.4)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 223.4)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 187.7)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 180.8)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 168.6)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 164.9)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 164.1)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 163.1)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 161.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 156.8)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 156.8)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 154.3)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 154)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 154)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 148.3)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 148.3)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 144.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 139.2)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 138.2)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 137.8)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 137.5)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 135.5)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 135.5)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 131.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 130.3)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 128.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 128.4)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 128.4)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 124.1)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 123.5)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 122.7)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 119.2)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 119.2)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 115.7)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 113.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 113.2)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 112.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 107)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 104.6)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 103.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 101.7)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 99.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 96.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 96.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 96.2)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 96.2)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 94)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 94)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 94)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 92.5)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 90.2)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 89.9)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.7)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.7)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 88.8)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 85.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 82.3)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 69.3)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 65.2)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 59.5)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 58.8)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 58.3)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 58.3)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 55.4)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 49.7)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 37.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 33.7)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 27.2)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 18.5)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 14.8)DNA metabolism DNA replication, recombination, and repair putative DNA helicase (TIGR00376; EC 3.6.4.12; HMM-score: 13.7)DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 12.4)
- TheSEED: see SAUSA300_0706
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 114.3)and 23 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 46.2)AAA_15; AAA ATPase domain (PF13175; HMM-score: 22.8)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 20.5)AAA_22; AAA domain (PF13401; HMM-score: 19.8)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.5)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 16.8)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 16.2)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 15.8)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 15.2)AAA_24; AAA domain (PF13479; HMM-score: 14.7)Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 14.6)AAA_23; AAA domain (PF13476; HMM-score: 14.6)AAA_30; AAA domain (PF13604; HMM-score: 14.6)AAA_18; AAA domain (PF13238; HMM-score: 14.4)RNA_helicase; RNA helicase (PF00910; HMM-score: 14.3)AAA_19; AAA domain (PF13245; HMM-score: 14.1)AAA_28; AAA domain (PF13521; HMM-score: 14)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 13.7)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 13.2)AAA_14; AAA domain (PF13173; HMM-score: 12.9)AAA_11; AAA domain (PF13086; HMM-score: 12)AAA_27; AAA domain (PF13514; HMM-score: 11.6)no clan defined DUF3987; Protein of unknown function (DUF3987) (PF13148; HMM-score: 11.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.021324
- TAT(Tat/SPI): 0.000538
- LIPO(Sec/SPII): 0.016684
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446511805 NCBI
- RefSeq: WP_000589260 NCBI
- UniProt: see SAUSA300_0706
⊟Protein sequence[edit | edit source]
- MIKFKNVTKRYGKHVAVDNISFNINEGEFFVLIGPSGCGKTTTLKMINRLIHLSEGYIYFKDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKEKDIDKRVDELLEMVGLEPEKYKNRKPDELSGGQRQRVGVIRALAADPPVILMDEPFSALDPISREKLQDDLIELQTKIKKTIIFVTHDIQEAMKLGDKICLLNEGHIEQIDTPEGFKNNPQSEFVKQFMGSHLEDDAPCVEENAIIRDLDIMKPIDEVTSMSAYPIVYDNQPIEVLYQLLSESERVIVMQEDSVGQYVIDRKDIFKYLSQKKEVAQHD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)