From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS05095 [old locus tag: SAUSA300_0948 ]
  • pan locus tag?: SAUPAN003248000
  • symbol: SAUSA300_RS05095
  • pan gene symbol?: menB
  • synonym:
  • product: 1,4-dihydroxy-2-naphthoyl-CoA synthase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS05095 [old locus tag: SAUSA300_0948 ]
  • symbol: SAUSA300_RS05095
  • product: 1,4-dihydroxy-2-naphthoyl-CoA synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 1036852..1037673
  • length: 822
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1036852..1037673) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGACTAACAGACAATGGGAAACACTTAGAGAATATGATGAAATCAAATATGAATTTTAC
    GAAGGGATTGCTAAGGTAACAATAAATCGCCCTGAAGTACGCAATGCGTTTACACCTAAA
    ACAGTTGCTGAAATGATTGACGCATTTTCACGTGCACGTGATGATCAAAACGTTTCAGTT
    ATCGTATTAACTGGTGAAGGTGATTTAGCATTCTGTTCTGGTGGTGACCAGAAGAAACGT
    GGACATGGTGGTTATGTAGGTGAAGACCAAATCCCTCGCTTAAATGTATTAGATTTACAG
    CGTTTAATTCGTATTATTCCAAAACCGGTTATCGCGATGGTAAAAGGTTATGCTGTAGGT
    GGCGGTAATGTACTAAATGTTGTTTGTGACTTAACGATTGCTGCTGATAATGCTATTTTT
    GGACAAACTGGTCCTAAAGTAGGTTCATTTGATGCGGGTTATGGTTCAGGATATTTAGCA
    CGTATCGTTGGACATAAGAAAGCACGTGAAATTTGGTACTTATGTCGTCAATACAATGCA
    CAAGAAGCTTTAGATATGGGTCTAGTAAATACAGTGGTACCTTTAGAGAAAGTTGAAGAT
    GAAACTGTGCAATGGTGTAAAGAGATTATGAAACACTCACCAACAGCGTTACGATTCCTT
    AAAGCAGCTATGAATGCTGACACAGATGGTTTAGCTGGTTTACAACAAATGGCTGGGGAT
    GCAACATTGCTTTATTACACAACTGATGAAGCGAAAGAAGGCCGTGATGCGTTTAAAGAA
    AAACGTGATCCTGACTTCGATCAATTCCCTAAATTCCCATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    822

Protein[edit | edit source]

Protein Data Bank: 2UZF

General[edit | edit source]

  • locus tag: SAUSA300_RS05095 [old locus tag: SAUSA300_0948 ]
  • symbol: SAUSA300_RS05095
  • description: 1,4-dihydroxy-2-naphthoyl-CoA synthase
  • length: 273
  • theoretical pI: 5.23939
  • theoretical MW: 30425.4
  • GRAVY: -0.358608

Function[edit | edit source]

  • reaction:
    EC 4.1.3.36?  ExPASy
    1,4-dihydroxy-2-naphthoyl-CoA synthase 4-(2-carboxyphenyl)-4-oxobutanoyl-CoA = 1,4-dihydroxy-2-naphthoyl-CoA + H2O
  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone naphthoate synthase (TIGR01929; EC 4.1.3.36; HMM-score: 424.3)
    and 9 more
    2-ketocyclohexanecarboxyl-CoA hydrolase (TIGR03210; EC 3.7.-.-; HMM-score: 315.5)
    phenylacetate degradation probable enoyl-CoA hydratase PaaB (TIGR02280; EC 4.2.1.17; HMM-score: 118.4)
    6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase (TIGR03200; EC 3.-.-.-; HMM-score: 101.6)
    Metabolism Fatty acid and phospholipid metabolism Degradation fatty oxidation complex, alpha subunit FadB (TIGR02437; EC 1.1.1.35,4.2.1.17,5.1.2.3,5.3.3.8; HMM-score: 56.8)
    cyclohexa-1,5-dienecarbonyl-CoA hydratase (TIGR03189; EC 4.2.1.100; HMM-score: 54.2)
    Metabolism Fatty acid and phospholipid metabolism Degradation fatty oxidation complex, alpha subunit FadJ (TIGR02440; EC 1.1.1.35,4.2.1.17,5.1.2.3; HMM-score: 48.2)
    fatty acid oxidation complex, alpha subunit, mitochondrial (TIGR02441; EC 1.1.1.35,4.2.1.17; HMM-score: 36.6)
    benzoyl-CoA-dihydrodiol lyase (TIGR03222; EC 4.1.2.44; HMM-score: 21.1)
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides signal peptide peptidase SppA, 36K type (TIGR00706; EC 3.4.-.-; HMM-score: 13.5)
  • TheSEED:
  • PFAM:
    ClpP_crotonase (CL0127) ECH_1; Enoyl-CoA hydratase/isomerase (PF00378; HMM-score: 298.6)
    and 5 more
    ECH_2; Enoyl-CoA hydratase/isomerase (PF16113; HMM-score: 76.4)
    NTF2 (CL0051) SnoaL_3; SnoaL-like domain (PF13474; HMM-score: 13.6)
    ClpP_crotonase (CL0127) Peptidase_S49; Peptidase family S49 (PF01343; HMM-score: 13.2)
    no clan defined DUF1666; Protein of unknown function (DUF1666) (PF07891; HMM-score: 12.7)
    ClpP_crotonase (CL0127) SDH_sah; Serine dehydrogenase proteinase (PF01972; HMM-score: 12.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: hydrogencarbonate
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004575
    • TAT(Tat/SPI): 0.000519
    • LIPO(Sec/SPII): 0.000587
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446107092 NCBI
  • RefSeq: WP_000184947 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MTNRQWETLREYDEIKYEFYEGIAKVTINRPEVRNAFTPKTVAEMIDAFSRARDDQNVSVIVLTGEGDLAFCSGGDQKKRGHGGYVGEDQIPRLNVLDLQRLIRIIPKPVIAMVKGYAVGGGNVLNVVCDLTIAADNAIFGQTGPKVGSFDAGYGSGYLARIVGHKKAREIWYLCRQYNAQEALDMGLVNTVVPLEKVEDETVQWCKEIMKHSPTALRFLKAAMNADTDGLAGLQQMAGDATLLYYTTDEAKEGRDAFKEKRDPDFDQFPKFP

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]