From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS05435 [old locus tag: SAUSA300_1010 ]
  • pan locus tag?: SAUPAN003337000
  • symbol: SAUSA300_RS05435
  • pan gene symbol?:
  • synonym:
  • product: DUF2197 domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS05435 [old locus tag: SAUSA300_1010 ]
  • symbol: SAUSA300_RS05435
  • product: DUF2197 domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1105774..1105941
  • length: 168
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    TTGAGACAAGTGCAATGCATTATCTGTGATGCAAAAGTATTTATAGATGAGCGCACAACT
    GAGTCTAAACGACTTAAAAACAATCCTATTCGAACATTTATGTGTGATGATTGTAAAAGT
    CGATTAGACACACCTAAACAACGTGCGCAACACTATCCGCTCGATTAA
    60
    120
    168

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS05435 [old locus tag: SAUSA300_1010 ]
  • symbol: SAUSA300_RS05435
  • description: DUF2197 domain-containing protein
  • length: 55
  • theoretical pI: 8.67223
  • theoretical MW: 6557.56
  • GRAVY: -0.88

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAUSA300_1010
  • PFAM:
    no clan defined DUF2197; Uncharacterized protein conserved in bacteria (DUF2197) (PF09963; HMM-score: 74.2)
    and 6 more
    DUF4428; Domain of unknown function (DUF4428) (PF14471; HMM-score: 15.3)
    C2H2-zf (CL0361) zf_UBZ; Ubiquitin-Binding Zinc Finger (PF18439; HMM-score: 15.1)
    Zn_Beta_Ribbon (CL0167) FdhE_C; FdhE, C-terminal domain (PF24860; HMM-score: 14.9)
    no clan defined zf-HYPF; HypF finger (PF07503; HMM-score: 14.6)
    Zn_Beta_Ribbon (CL0167) Lar_restr_allev; Restriction alleviation protein Lar (PF14354; HMM-score: 13.1)
    C2H2-zf (CL0361) zf-C2H2_jaz; Zinc-finger double-stranded RNA-binding (PF12171; HMM-score: 12.4)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9686
    • Cytoplasmic Membrane Score: 0.0104
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.0203
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.042593
    • TAT(Tat/SPI): 0.002697
    • LIPO(Sec/SPII): 0.015971
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRQVQCIICDAKVFIDERTTESKRLKNNPIRTFMCDDCKSRLDTPKQRAQHYPLD

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]