Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS06045 [old locus tag: SAUSA300_1117 ]
- pan locus tag?: SAUPAN003507000
- symbol: SAUSA300_RS06045
- pan gene symbol?: rpmB
- synonym:
- product: 50S ribosomal protein L28
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS06045 [old locus tag: SAUSA300_1117 ]
- symbol: SAUSA300_RS06045
- product: 50S ribosomal protein L28
- replicon: chromosome
- strand: -
- coordinates: 1222920..1223108
- length: 189
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1222920..1223108) NCBI
- BioCyc: SAUSA300_RS06045 BioCyc
- MicrobesOnline: see SAUSA300_1117
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGGTAAACAATGTTTCGTAACAGGTCGTAAAGCTTCGACTGGTAACAGACGTTCACAC
GCTTTAAACTCTACTAAACGTAGATGGAACGCTAACCTTCAAAAAGTTAGAATCCTAGTT
GACGGTAAACCTAAAAAAGTTTGGGTTTCTGCACGTGCTTTAAAATCTGGTAAAGTAACT
AGAGTTTAA60
120
180
189
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS06045 [old locus tag: SAUSA300_1117 ]
- symbol: SAUSA300_RS06045
- description: 50S ribosomal protein L28
- length: 62
- theoretical pI: 12.7454
- theoretical MW: 6977.18
- GRAVY: -0.737097
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL28 (TIGR00009; HMM-score: 73.4)
- TheSEED: see SAUSA300_1117
- PFAM: no clan defined Ribosomal_L28; Ribosomal L28 family (PF00830; HMM-score: 68)and 1 moreUbiquitin (CL0072) DUF348; G5-linked-Ubiquitin-like domain (PF03990; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.2164
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.7836
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.053732
- TAT(Tat/SPI): 0.026326
- LIPO(Sec/SPII): 0.016121
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446440053 NCBI
- RefSeq: WP_000517908 NCBI
- UniProt: see SAUSA300_1117
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVTRV
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]