From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS06900 [old locus tag: SAUSA300_1271 ]
  • pan locus tag?: SAUPAN003780000
  • symbol: SAUSA300_RS06900
  • pan gene symbol?:
  • synonym:
  • product: hydrolase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS06900 [old locus tag: SAUSA300_1271 ]
  • symbol: SAUSA300_RS06900
  • product: hydrolase
  • replicon: chromosome
  • strand: +
  • coordinates: 1400275..1401042
  • length: 768
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1400275..1401042) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAGATTTGTCTTTGATATTGATGGTACGCTTTGTTTTGACGGCCGATTAATTGACCAG
    ACTATTATTGATACATTGTTACAATTACAACATGATGGTCATGAACTTATATTTGCATCA
    GCACGTCCGATTCGTGATTTGTTGCCAGTTTTACCATCAGTATTTCATCAGCACACATTA
    ATTGGCGCAAATGGTGCTATGATTTCACAGCAATCAAAGATTTCTGTTATCAAACCAATT
    CATACTGATACATATCATCATATCTTCAAAATAATTCAAAAGTATGAGTTAGATTATATT
    ATTGATGATGATTGGAATTATGCTGCACAACTTGACGCTGAGAACGCGATTTTTGAGCGT
    TTAGATCCACATAAGCTGGCCAGTTGTATTGATGTTGCAAATATCGACACACCAATCAAG
    ATTATTTTATTAAATATAGACCCGGCACAAATTACAACTATATTAGACGAGCTAGATAAA
    TACCATCAAGAATTGGAAATGATTCACCATTCAAATGAGTATAACATTGATATAACAGCG
    CAAAATATTAACAAATATACTGCATTACAATATATATTTGATGCAGATGTTAAATATATA
    GCATTTGGTAATGACCACAATGATATTGTCATGTTACAACATGCTAGTAGTGGCTATATT
    ATAGGACCATCAGAAGCATACACACACGCAATATTGAAACTTGATAAAATCAAACACATC
    AATAATAATGCACAAGCTATTTGCAAAGTCTTAAAATCATATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    768

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS06900 [old locus tag: SAUSA300_1271 ]
  • symbol: SAUSA300_RS06900
  • description: hydrolase
  • length: 255
  • theoretical pI: 5.61772
  • theoretical MW: 29147.1
  • GRAVY: -0.092549

Function[edit | edit source]

  • TIGRFAM:
    Unknown function Enzymes of unknown specificity Cof-like hydrolase (TIGR00099; HMM-score: 182.3)
    and 3 more
    Unknown function Enzymes of unknown specificity HAD hydrolase, family IIB (TIGR01484; HMM-score: 62.9)
    phosphoglycolate phosphatase, TA0175-type (TIGR01487; EC 3.1.3.18; HMM-score: 24.7)
    mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 16.9)
  • TheSEED:
  • PFAM:
    HAD (CL0137) Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 124.7)
    and 5 more
    S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 22.4)
    no clan defined Ead_Ea22; Ead/Ea22-like protein (PF13935; HMM-score: 13.7)
    HHH (CL0198) HHH_7; Helix-hairpin-helix motif (PF14635; HMM-score: 13.1)
    HAD (CL0137) Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 12.7)
    TIM_barrel (CL0036) TMP-TENI; Thiamine monophosphate synthase (PF02581; HMM-score: 12.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002704
    • TAT(Tat/SPI): 0.000171
    • LIPO(Sec/SPII): 0.000245
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 447135763 NCBI
  • RefSeq: WP_001213019 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MRFVFDIDGTLCFDGRLIDQTIIDTLLQLQHDGHELIFASARPIRDLLPVLPSVFHQHTLIGANGAMISQQSKISVIKPIHTDTYHHIFKIIQKYELDYIIDDDWNYAAQLDAENAIFERLDPHKLASCIDVANIDTPIKIILLNIDPAQITTILDELDKYHQELEMIHHSNEYNIDITAQNINKYTALQYIFDADVKYIAFGNDHNDIVMLQHASSGYIIGPSEAYTHAILKLDKIKHINNNAQAICKVLKSYK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]