From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS06920 [old locus tag: SAUSA300_1275 ]
  • pan locus tag?: SAUPAN003786000
  • symbol: SAUSA300_RS06920
  • pan gene symbol?: opp-2C
  • synonym:
  • product: peptide ABC transporter permease

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS06920 [old locus tag: SAUSA300_1275 ]
  • symbol: SAUSA300_RS06920
  • product: peptide ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 1403141..1403971
  • length: 831
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (1403141..1403971) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGCATAAAATATTTTCAAAGAATAACCTGATATTTTTTGTATTCGTTGCATTTATTTTT
    GTGGTAATTGTACTGCAATTCTTTGTCAGTAGTGAAAATGCAACCAAAGTCAATTTATCA
    CAAACTTTTGAACCTATTAGTTGGTTGCATTTATTAGGAACTGATGATTATGGGAGAGAT
    TTATTTACCCGAATTATTATCGGTGCACGTTCAACATTGTTTGTTACTGTTTTAACATTA
    ATAGCTATCGTTGTCATAGGTGTTACACTAGGTCTATTTGCCGGATACAAAAAAGGGTGG
    ATTGAACGATTAGTGTTAAGGTTTATTGATGTTGGTCTAAGTATTCCAGAATTTATCATC
    ATGATTGCTTTAGCAAGTTTTTTTCAACCATCTTTATGGAATTTAGTTATCTCAATTACA
    TTAATAAAATGGATGAATTACACAAGGTTGACTAGAAGTATAGTTAATAGCGAAATGAAT
    AAGCCTTATATAAAAATGGCACAATTATTTCATGTACCAACAAGAACAATATTAATACGT
    CATTTAACACCTAAAATTATACCGGCTATTATCGTTTTGATGGTCGTTGATTTCGGTAAA
    ATCATTCTATATATAAGTTCACTATCATTTATTGGGTTAGGTGCACAACCGCCAACACCA
    GAGTGGGGCGCTATGTTGCAACAAGGTCGTGATTTTATTTCGTCTCATCCAATTATGTTG
    ATTGCACCTGCTTCAGTCATTGCTATAACTATTTTAATTTTTAATTTAACCGGTGATGCA
    CTAAGAGATAGATTGCTGAAACAACGGGGTGAATATGATGAGTCTCATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    831

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS06920 [old locus tag: SAUSA300_1275 ]
  • symbol: SAUSA300_RS06920
  • description: peptide ABC transporter permease
  • length: 276
  • theoretical pI: 10.2524
  • theoretical MW: 31255.1
  • GRAVY: 0.687319

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel ABC transporter, permease subunit NikC (TIGR02790; EC 3.6.3.24; HMM-score: 247.7)
    and 2 more
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel ABC transporter, permease subunit NikB (TIGR02789; EC 3.6.3.24; HMM-score: 22.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (TIGR01726; HMM-score: 18.6)
  • TheSEED:
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 94.5)
    and 1 more
    no clan defined DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 6.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.332973
    • TAT(Tat/SPI): 0.001421
    • LIPO(Sec/SPII): 0.050311
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit | edit source]

  • GI: 446471078 NCBI
  • RefSeq: WP_000548932 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MHKIFSKNNLIFFVFVAFIFVVIVLQFFVSSENATKVNLSQTFEPISWLHLLGTDDYGRDLFTRIIIGARSTLFVTVLTLIAIVVIGVTLGLFAGYKKGWIERLVLRFIDVGLSIPEFIIMIALASFFQPSLWNLVISITLIKWMNYTRLTRSIVNSEMNKPYIKMAQLFHVPTRTILIRHLTPKIIPAIIVLMVVDFGKIILYISSLSFIGLGAQPPTPEWGAMLQQGRDFISSHPIMLIAPASVIAITILIFNLTGDALRDRLLKQRGEYDESH

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]