From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS07685 [old locus tag: SAUSA300_1409 ]
  • pan locus tag?: SAUPAN001769000
  • symbol: SAUSA300_RS07685
  • pan gene symbol?:
  • synonym:
  • product: VRR-NUC domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS07685 [old locus tag: SAUSA300_1409 ]
  • symbol: SAUSA300_RS07685
  • product: VRR-NUC domain-containing protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1574456..1574746
  • length: 291
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAGAATCGACATTAGAAAAATATTTAGTGAAAGAGATATCAAAGCTAAACGGTTTA
    TGTTTAAAATGGGTTGCACCTGGAACAAGAGGTGTGCCAGATAGAATTATTATTATGCCA
    GAAGGAAAAACATATTTTGTAGAAATGAAGCAAGAAAAAGGAAAGTTGCATCCTTTACAA
    AAATATGTGCATAGACAATTTGAAAATAGAGATCATAAAGTATATGTGTTATGGAATAAA
    GAACAAGTAAATACTTTTATCAGAATGGTAGGTGGAACATTTGGCGATTGA
    60
    120
    180
    240
    291

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS07685 [old locus tag: SAUSA300_1409 ]
  • symbol: SAUSA300_RS07685
  • description: VRR-NUC domain-containing protein
  • length: 96
  • theoretical pI: 10.1063
  • theoretical MW: 11296.2
  • GRAVY: -0.555208

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAUSA300_1409
  • PFAM:
    PDDEXK (CL0236) VRR_NUC; VRR-NUC domain (PF08774; HMM-score: 25.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9912
    • Cytoplasmic Membrane Score: 0.0012
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0073
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005739
    • TAT(Tat/SPI): 0.00064
    • LIPO(Sec/SPII): 0.002208
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKESTLEKYLVKEISKLNGLCLKWVAPGTRGVPDRIIIMPEGKTYFVEMKQEKGKLHPLQKYVHRQFENRDHKVYVLWNKEQVNTFIRMVGGTFGD

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]