Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07685 [old locus tag: SAUSA300_1409 ]
- pan locus tag?: SAUPAN001769000
- symbol: SAUSA300_RS07685
- pan gene symbol?: —
- synonym:
- product: VRR-NUC domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07685 [old locus tag: SAUSA300_1409 ]
- symbol: SAUSA300_RS07685
- product: VRR-NUC domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1574456..1574746
- length: 291
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1574456..1574746) NCBI
- BioCyc: SAUSA300_RS07685 BioCyc
- MicrobesOnline: see SAUSA300_1409
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAGAATCGACATTAGAAAAATATTTAGTGAAAGAGATATCAAAGCTAAACGGTTTA
TGTTTAAAATGGGTTGCACCTGGAACAAGAGGTGTGCCAGATAGAATTATTATTATGCCA
GAAGGAAAAACATATTTTGTAGAAATGAAGCAAGAAAAAGGAAAGTTGCATCCTTTACAA
AAATATGTGCATAGACAATTTGAAAATAGAGATCATAAAGTATATGTGTTATGGAATAAA
GAACAAGTAAATACTTTTATCAGAATGGTAGGTGGAACATTTGGCGATTGA60
120
180
240
291
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07685 [old locus tag: SAUSA300_1409 ]
- symbol: SAUSA300_RS07685
- description: VRR-NUC domain-containing protein
- length: 96
- theoretical pI: 10.1063
- theoretical MW: 11296.2
- GRAVY: -0.555208
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1409
- PFAM: PDDEXK (CL0236) VRR_NUC; VRR-NUC domain (PF08774; HMM-score: 25.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9912
- Cytoplasmic Membrane Score: 0.0012
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0073
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005739
- TAT(Tat/SPI): 0.00064
- LIPO(Sec/SPII): 0.002208
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 486200072 NCBI
- RefSeq: WP_001548892 NCBI
- UniProt: see SAUSA300_1409
⊟Protein sequence[edit | edit source]
- MKESTLEKYLVKEISKLNGLCLKWVAPGTRGVPDRIIIMPEGKTYFVEMKQEKGKLHPLQKYVHRQFENRDHKVYVLWNKEQVNTFIRMVGGTFGD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]