From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS07835 [old locus tag: SAUSA300_1436 ]
  • pan locus tag?: SAUPAN001316000
  • symbol: SAUSA300_RS07835
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS07835 [old locus tag: SAUSA300_1436 ]
  • symbol: SAUSA300_RS07835
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1588902..1589336
  • length: 435
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAAAAGTAATCGGACTGCTACTAGTAAGTACATTAGCTTTAACAGCTTGTGGTGAA
    AAAGAAAAACCAAAAAAAGAAGAAAATAAAAAGTCACAAACACAAAATCACAAAGATAGC
    AAACCAAAAACGCAACAAGAAAAAATGAAAAAAGTTGAAGATAAAAATCCACCTAATAAT
    AGCATACAAAATAATTCAAACAATCAAAACCAATCACAAAACAATCAACTTAATAATAAT
    TCAGATCCATCTAATAATACTCCTGCAAATATAAATGAAAACGATTCACAAAATACTAAT
    TTAAATGATGAGTATGTCGTTTCGCCTGGCTGGACTAAAGATGAACAGGCTAAAGCTTTT
    GAAGAGTACAAAAAAGGAAAAGAAGAGGAAGCAAGAGCTGGTGCTAGCGCAGTACCAGGA
    GCCAATATTAACTAA
    60
    120
    180
    240
    300
    360
    420
    435


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS07835 [old locus tag: SAUSA300_1436 ]
  • symbol: SAUSA300_RS07835
  • description: hypothetical protein
  • length: 144
  • theoretical pI: 8.4454
  • theoretical MW: 15995.3
  • GRAVY: -1.50833

Function[edit | edit source]

  • TIGRFAM:
    Sec region non-globular protein (TIGR04420; HMM-score: 15.2)
    mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 12.2)
    and 11 more
    Genetic information processing Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 12.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 9.4)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 7)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cation transporter family protein (TIGR00860; HMM-score: 6.7)
    Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 6.6)
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 6.1)
    Metabolism Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 5.7)
    pullulanase, extracellular (TIGR02102; HMM-score: 5.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 4.6)
    Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 2.5)
    Metabolism Transport and binding proteins Cations and iron carrying compounds K+-dependent Na+/Ca+ exchanger (TIGR00927; HMM-score: 2.1)
  • TheSEED: see SAUSA300_1436
  • PFAM:
    no clan defined PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 13.9)
    DUF6491; Family of unknown function (DUF6491) (PF20101; HMM-score: 13.3)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 12.6)
    no clan defined FAM76; FAM76 protein (PF16046; HMM-score: 12.5)
    and 12 more
    Calcineurin (CL0163) PGA_cap; Bacterial capsule synthesis protein PGA_cap (PF09587; HMM-score: 10.3)
    DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 9.3)
    no clan defined DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 9.1)
    Omega_toxin (CL0083) Conotoxin; Conotoxin (PF02950; HMM-score: 7.6)
    no clan defined Serinc; Serine incorporator (Serinc) (PF03348; HMM-score: 7.6)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 7.3)
    no clan defined Med24_N; Mediator complex subunit 24 N-terminal (PF11277; HMM-score: 7.2)
    FAM60A; Protein Family FAM60A (PF15396; HMM-score: 6.8)
    DUF5870; Family of unknown function (DUF5870) (PF19195; HMM-score: 6)
    TPR (CL0020) Vir1p; Virilizer, yeast (PF22575; HMM-score: 5.9)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 5.6)
    no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 5.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.82
    • Extracellular Score: 9.13
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0059
    • Cytoplasmic Membrane Score: 0.4175
    • Cell wall & surface Score: 0.125
    • Extracellular Score: 0.4517
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000459
    • TAT(Tat/SPI): 0.000066
    • LIPO(Sec/SPII): 0.999246
    • Cleavage Site: CS pos: 17-18. LTA-CG. Pr: 0.9998
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKKVIGLLLVSTLALTACGEKEKPKKEENKKSQTQNHKDSKPKTQQEKMKKVEDKNPPNNSIQNNSNNQNQSQNNQLNNNSDPSNNTPANINENDSQNTNLNDEYVVSPGWTKDEQAKAFEEYKKGKEEEARAGASAVPGANIN

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]