Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS07835 [old locus tag: SAUSA300_1436 ]
- pan locus tag?: SAUPAN001316000
- symbol: SAUSA300_RS07835
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS07835 [old locus tag: SAUSA300_1436 ]
- symbol: SAUSA300_RS07835
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1588902..1589336
- length: 435
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1588902..1589336) NCBI
- BioCyc: SAUSA300_RS07835 BioCyc
- MicrobesOnline: see SAUSA300_1436
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAAAAAGTAATCGGACTGCTACTAGTAAGTACATTAGCTTTAACAGCTTGTGGTGAA
AAAGAAAAACCAAAAAAAGAAGAAAATAAAAAGTCACAAACACAAAATCACAAAGATAGC
AAACCAAAAACGCAACAAGAAAAAATGAAAAAAGTTGAAGATAAAAATCCACCTAATAAT
AGCATACAAAATAATTCAAACAATCAAAACCAATCACAAAACAATCAACTTAATAATAAT
TCAGATCCATCTAATAATACTCCTGCAAATATAAATGAAAACGATTCACAAAATACTAAT
TTAAATGATGAGTATGTCGTTTCGCCTGGCTGGACTAAAGATGAACAGGCTAAAGCTTTT
GAAGAGTACAAAAAAGGAAAAGAAGAGGAAGCAAGAGCTGGTGCTAGCGCAGTACCAGGA
GCCAATATTAACTAA60
120
180
240
300
360
420
435
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS07835 [old locus tag: SAUSA300_1436 ]
- symbol: SAUSA300_RS07835
- description: hypothetical protein
- length: 144
- theoretical pI: 8.4454
- theoretical MW: 15995.3
- GRAVY: -1.50833
⊟Function[edit | edit source]
- TIGRFAM: Sec region non-globular protein (TIGR04420; HMM-score: 15.2)mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 12.2)and 11 moreProtein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 12.1)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 9.4)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 7)Transport and binding proteins Cations and iron carrying compounds cation transporter family protein (TIGR00860; HMM-score: 6.7)Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 6.6)cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 6.1)Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 5.7)pullulanase, extracellular (TIGR02102; HMM-score: 5.4)Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 4.6)Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 2.5)Transport and binding proteins Cations and iron carrying compounds K+-dependent Na+/Ca+ exchanger (TIGR00927; HMM-score: 2.1)
- TheSEED: see SAUSA300_1436
- PFAM: LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 13.6)no clan defined DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 13.4)DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 13)FAM76; FAM76 protein (PF16046; HMM-score: 12.7)and 11 moreDMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 9.2)Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 8.6)no clan defined Med24_N; Mediator complex subunit 24 N-terminal (PF11277; HMM-score: 6.7)FAM60A; Protein Family FAM60A (PF15396; HMM-score: 6.7)SLC12; Solute carrier family 12 (PF03522; HMM-score: 6.6)CPA_AT (CL0064) Mem_trans; Membrane transport protein (PF03547; HMM-score: 5.7)no clan defined CLN3; CLN3 protein (PF02487; HMM-score: 5.5)FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 5.5)no clan defined LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 5.4)GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 5.4)no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 5.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.82
- Extracellular Score: 9.13
- Internal Helices: 0
- LocateP:
- SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
- SP(Sec/SPI): 0.000459
- TAT(Tat/SPI): 0.000066
- LIPO(Sec/SPII): 0.999246
- Cleavage Site: CS pos: 17-18. LTA-CG. Pr: 0.9998
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446678376 NCBI
- RefSeq: WP_000755722 NCBI
- UniProt: see SAUSA300_1436
⊟Protein sequence[edit | edit source]
- MKKVIGLLLVSTLALTACGEKEKPKKEENKKSQTQNHKDSKPKTQQEKMKKVEDKNPPNNSIQNNSNNQNQSQNNQLNNNSDPSNNTPANINENDSQNTNLNDEYVVSPGWTKDEQAKAFEEYKKGKEEEARAGASAVPGANIN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.