PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_1436 [new locus tag: SAUSA300_RS07835 ]
• pan locus tag^?: SAUPAN001316000
• symbol: SAUSA300_1436
• pan gene symbol^?: —
• synonym:
• product: phiSLT ORF144-like protein lipoprotein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_1436 [new locus tag: SAUSA300_RS07835 ]
• symbol: SAUSA300_1436
• product: phiSLT ORF144-like protein lipoprotein
• replicon: chromosome
• strand: +
• coordinates: 1588902..1589336
• length: 435
• essential: unknown

⊟Accession numbers

• Gene ID: 3913869 NCBI
• RefSeq: YP_494133 NCBI
• BioCyc: see SAUSA300_RS07835
• MicrobesOnline: 1292951 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  421
  
  ATGAAAAAAGTAATCGGACTGCTACTAGTAAGTACATTAGCTTTAACAGCTTGTGGTGAA
  AAAGAAAAACCAAAAAAAGAAGAAAATAAAAAGTCACAAACACAAAATCACAAAGATAGC
  AAACCAAAAACGCAACAAGAAAAAATGAAAAAAGTTGAAGATAAAAATCCACCTAATAAT
  AGCATACAAAATAATTCAAACAATCAAAACCAATCACAAAACAATCAACTTAATAATAAT
  TCAGATCCATCTAATAATACTCCTGCAAATATAAATGAAAACGATTCACAAAATACTAAT
  TTAAATGATGAGTATGTCGTTTCGCCTGGCTGGACTAAAGATGAACAGGCTAAAGCTTTT
  GAAGAGTACAAAAAAGGAAAAGAAGAGGAAGCAAGAGCTGGTGCTAGCGCAGTACCAGGA
  GCCAATATTAACTAA
  60
  120
  180
  240
  300
  360
  420
  435
  

⊟Protein

⊟General

• locus tag: SAUSA300_1436 [new locus tag: SAUSA300_RS07835 ]
• symbol: SAUSA300_1436
• description: phiSLT ORF144-like protein lipoprotein
• length: 144
• theoretical pI: 8.4454
• theoretical MW: 15995.3
• GRAVY: -1.50833

⊟Function

• TIGRFAM:
  Sec region non-globular protein (TIGR04420; HMM-score: 15.2)
  mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 12.2)
  and 11 more
  Genetic information processing Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfiO (TIGR03302; HMM-score: 12.1)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 9.4)
  Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 7)
  Metabolism Transport and binding proteins Cations and iron carrying compounds cation transporter family protein (TIGR00860; HMM-score: 6.7)
  Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 6.6)
  cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 6.1)
  Metabolism Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 5.7)
  pullulanase, extracellular (TIGR02102; HMM-score: 5.4)
  Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 4.6)
  Metabolism Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 2.5)
  Metabolism Transport and binding proteins Cations and iron carrying compounds K+-dependent Na+/Ca+ exchanger (TIGR00927; HMM-score: 2.1)
• TheSEED  :
  • Phage protein
• PFAM:
  no clan defined PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 13.9)
  DUF6491; Family of unknown function (DUF6491) (PF20101; HMM-score: 13.3)
  LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 12.6)
  no clan defined FAM76; FAM76 protein (PF16046; HMM-score: 12.5)
  and 12 more
  Calcineurin (CL0163) PGA_cap; Bacterial capsule synthesis protein PGA_cap (PF09587; HMM-score: 10.3)
  DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 9.3)
  no clan defined DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 9.1)
  Omega_toxin (CL0083) Conotoxin; Conotoxin (PF02950; HMM-score: 7.6)
  no clan defined Serinc; Serine incorporator (Serinc) (PF03348; HMM-score: 7.6)
  Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 7.3)
  no clan defined Med24_N; Mediator complex subunit 24 N-terminal (PF11277; HMM-score: 7.2)
  FAM60A; Protein Family FAM60A (PF15396; HMM-score: 6.8)
  DUF5870; Family of unknown function (DUF5870) (PF19195; HMM-score: 6)
  TPR (CL0020) Vir1p; Virilizer, yeast (PF22575; HMM-score: 5.9)
  FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 5.6)
  no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 5.3)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Extracellular
  • Cytoplasmic Score: 0
  • Cytoplasmic Membrane Score: 0.05
  • Cellwall Score: 0.82
  • Extracellular Score: 9.13
  • Internal Helices: 0
• DeepLocPro: Extracellular
  • Cytoplasmic Score: 0.0059
  • Cytoplasmic Membrane Score: 0.4175
  • Cell wall & surface Score: 0.125
  • Extracellular Score: 0.4517
• LocateP: Lipid anchored
  • Prediction by SwissProt Classification: Extracellular
  • Pathway Prediction: Sec-(SPII)
  • Intracellular possibility: 0
  • Signal peptide possibility: 0.5
  • N-terminally Anchored Score: -1
  • Predicted Cleavage Site: ALTACGE
• SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
  • SP(Sec/SPI): 0.000459
  • TAT(Tat/SPI): 0.000066
  • LIPO(Sec/SPII): 0.999246
  • Cleavage Site: CS pos: 17-18. LTA-CG. Pr: 0.9998
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 87161260 NCBI
• RefSeq: YP_494133 NCBI
• UniProt: A0A0H2XG92 UniProt

⊟Protein sequence

• MKKVIGLLLVSTLALTACGEKEKPKKEENKKSQTQNHKDSKPKTQQEKMKKVEDKNPPNNSIQNNSNNQNQSQNNQLNNNSDPSNNTPANINENDSQNTNLNDEYVVSPGWTKDEQAKAFEEYKKGKEEEARAGASAVPGANIN

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SAUSA300_1434 > SAUSA300_1435 > SAUSA300_1436

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You can add further information about the gene and protein here. [edit]

⊟Literature

⊟References

⊟Relevant publications