Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS08105 [old locus tag: SAUSA300_1485 ]
- pan locus tag?: SAUPAN004099000
- symbol: SAUSA300_RS08105
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS08105 [old locus tag: SAUSA300_1485 ]
- symbol: SAUSA300_RS08105
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1640305..1640565
- length: 261
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1640305..1640565) NCBI
- BioCyc: SAUSA300_RS08105 BioCyc
- MicrobesOnline: see SAUSA300_1485
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGTGGTTTATTTAATTTTTTTGTTTTAGGTGCTGACCGTCCATCACTTGGTGGAGTT
GGTGACTGGATAAGTAATGAAGTAGGTACGGGTATTGGTTTAGTAGTATTGGTTGTTGGT
ATTGTAAAATGGGCTAGTGGTAAATATGGGCATATGGTTATATTATTTGTTGTTGGTGGC
TTTTTATTCTTAGTTTCTAAAGGTCCTGAACAGGTATTTAATGCGATTGCAGGTGTTTGG
AAAATGATTTTTGGCGGTTGA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS08105 [old locus tag: SAUSA300_1485 ]
- symbol: SAUSA300_RS08105
- description: hypothetical protein
- length: 86
- theoretical pI: 9.19081
- theoretical MW: 9032.64
- GRAVY: 0.947674
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_1485
- PFAM: TrbC_VirB2 (CL0690) T4SS_pilin; Type IV secretion system pilin (PF18895; HMM-score: 10.7)no clan defined CyanoTRADDas_TM; Cyanobacterial TRADD-N associated 2-Transmembrane domain (PF20712; HMM-score: 9.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0007
- Cytoplasmic Membrane Score: 0.4459
- Cell wall & surface Score: 0
- Extracellular Score: 0.5533
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007615
- TAT(Tat/SPI): 0.000229
- LIPO(Sec/SPII): 0.004917
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI: 445937784 NCBI
- RefSeq: WP_000015639 NCBI
- UniProt: see SAUSA300_1485
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSGLFNFFVLGADRPSLGGVGDWISNEVGTGIGLVVLVVGIVKWASGKYGHMVILFVVGGFLFLVSKGPEQVFNAIAGVWKMIFGG
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]