From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS08150 [old locus tag: SAUSA300_1493 ]
  • pan locus tag?: SAUPAN004109000
  • symbol: SAUSA300_RS08150
  • pan gene symbol?: —
  • synonym:
  • product: membrane protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS08150 [old locus tag: SAUSA300_1493 ]
  • symbol: SAUSA300_RS08150
  • product: membrane protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1646762..1646980
  • length: 219
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGCGTAATATAATATTTTATCTTGTACTTATTATTGCTGCGATTGGATTAGTAATGAAT
    CTAGATGCCTTTATTTTTTCAATCGTCAGAATGTTAATCAGCTTTGCTGTAATAGCTGGT
    ATTATTTATCTGATTTATTATTTCTTCATCTTAACTGAAGACCAACGCAAATATCGCAAA
    GCAATGCGTAAGTATAAAAGAAATCAAAGAAGAAAATAG
    60
    120
    180
    219

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_RS08150 [old locus tag: SAUSA300_1493 ]
  • symbol: SAUSA300_RS08150
  • description: membrane protein
  • length: 72
  • theoretical pI: 11.08
  • theoretical MW: 8728.64
  • GRAVY: 0.593056

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssB (TIGR03926; HMM-score: 15.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 14.8)
    Cellular processes Cellular processes Toxin production and resistance bacteriocin-associated integral membrane protein (TIGR01654; HMM-score: 12.7)
    and 1 more
    integral membrane protein (TIGR04561; HMM-score: 8)
  • TheSEED: see SAUSA300_1493
  • PFAM:
    no clan defined Orf78; Orf78 (ac78) (PF06024; HMM-score: 21.2)
    and 12 more
    PrgI; PrgI family protein (PF12666; HMM-score: 15.4)
    PKinase (CL0016) YukC; WXG100 protein secretion system (Wss), protein YukC (PF10140; HMM-score: 14.7)
    no clan defined YitT_membrane; Uncharacterised 5xTM membrane BCR, YitT family COG1284 (PF02588; HMM-score: 14.2)
    IncA; IncA protein (PF04156; HMM-score: 13.6)
    MIM-OM_import (CL0455) TIM21; TIM21 (PF08294; HMM-score: 13.5)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 12.9)
    no clan defined DUF5326; Family of unknown function (DUF5326) (PF17260; HMM-score: 12.7)
    Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 11.6)
    no clan defined COX6C; Cytochrome c oxidase subunit VIc (PF02937; HMM-score: 10.5)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 10)
    FtsH_ext; FtsH Extracellular (PF06480; HMM-score: 9.7)
    DUF5305; Family of unknown function (DUF5305) (PF17231; HMM-score: 6.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011143
    • TAT(Tat/SPI): 0.000159
    • LIPO(Sec/SPII): 0.039977
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRKAMRKYKRNQRRK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_RS08150&oldid=91981"