From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS08470 [old locus tag: SAUSA300_1554 ]
  • pan locus tag?: SAUPAN004181000
  • symbol: SAUSA300_RS08470
  • pan gene symbol?:
  • synonym: yhbY
  • product: RNA-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS08470 [old locus tag: SAUSA300_1554 ]
  • symbol: SAUSA300_RS08470
  • product: RNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1703934..1704224
  • length: 291
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCTTACTGGCAAACAAAAAAGATACTTAAGAAGTTTAGCACACAATATTGATCCGATT
    TTTCAAATTGGAAAAGGCGGTATCAACGAAAATATGATTAAACAAATAGATGATACGTTA
    GAAAACAGAGAATTGATTAAAGTACATGTACTACAAAATAACTTTGATGATAAAAAAGAA
    TTAGCTGAAACATTAAGCGAAGCTACTCATAGTGAATTAGTGCAAGTGATTGGATCTATG
    ATAGTGATTTATAGAGAATCTAAAGATAATAAAGAAATTGAATTGCCATAA
    60
    120
    180
    240
    291

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS08470 [old locus tag: SAUSA300_1554 ]
  • symbol: SAUSA300_RS08470
  • description: RNA-binding protein
  • length: 96
  • theoretical pI: 5.65938
  • theoretical MW: 11047.6
  • GRAVY: -0.521875

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General putative RNA-binding protein, YhbY family (TIGR00253; HMM-score: 130)
  • TheSEED: see SAUSA300_1554
  • PFAM:
    no clan defined CRS1_YhbY; CRS1 / YhbY (CRM) domain (PF01985; HMM-score: 116)
    and 4 more
    HMA (CL0704) HMA_2; Heavy metal associated domain 2 (PF19991; HMM-score: 16.4)
    no clan defined DUF1217; Protein of unknown function (DUF1217) (PF06748; HMM-score: 12.8)
    NADP_Rossmann (CL0063) NAD_Gly3P_dh_N; NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus (PF01210; HMM-score: 12.5)
    TIM_barrel (CL0036) Glyco_hydro_59; Glycosyl hydrolase family 59 (PF02057; HMM-score: 11.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9894
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0102
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002297
    • TAT(Tat/SPI): 0.00015
    • LIPO(Sec/SPII): 0.000525
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLTGKQKRYLRSLAHNIDPIFQIGKGGINENMIKQIDDTLENRELIKVHVLQNNFDDKKELAETLSEATHSELVQVIGSMIVIYRESKDNKEIELP

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]