Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS10425 [old locus tag: SAUSA300_1904 ]
- pan locus tag?: SAUPAN004972000
- symbol: SAUSA300_RS10425
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS10425 [old locus tag: SAUSA300_1904 ]
- symbol: SAUSA300_RS10425
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2071440..2071613
- length: 174
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2071440..2071613) NCBI
- BioCyc: see SAUSA300_1904
- MicrobesOnline: see SAUSA300_1904
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGTGGAATTTTATTAAATGTGTGTTTAAATTCGTATTTAGCTTAGTTGCTATTACAACA
TTAGTTGCTGGTGTTGGTGTAGTAGCATTTGCTTATATCTTTAAAAAAGATTTTGAAGAT
ATTGAAAGAAAAACTAAAGAAATTATTTCTGATATTGAAAGTAAAAATAACTAA60
120
174
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS10425 [old locus tag: SAUSA300_1904 ]
- symbol: SAUSA300_RS10425
- description: hypothetical protein
- length: 57
- theoretical pI: 8.49847
- theoretical MW: 6564.7
- GRAVY: 0.445614
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein modification and repair cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)Energy metabolism Electron transport cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)
- TheSEED: see SAUSA300_1904
- PFAM: no clan defined FixS; Cytochrome oxidase maturation protein cbb3-type (PF03597; HMM-score: 16.8)and 2 moreDUF3927; Protein of unknown function (DUF3927) (PF13064; HMM-score: 13)DUF3918; Protein of unknown function (DUF3918) (PF13056; HMM-score: 11.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.384612
- TAT(Tat/SPI): 0.007845
- LIPO(Sec/SPII): 0.041173
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI: 446189179 NCBI
- RefSeq: WP_000267034 NCBI
- UniProt: see SAUSA300_1904
⊟Protein sequence[edit | edit source]
- MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]