From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS10740 [old locus tag: SAUSA300_1958 ]
  • pan locus tag?: SAUPAN001395000
  • symbol: SAUSA300_RS10740
  • pan gene symbol?: ssb2
  • synonym:
  • product: single-stranded DNA-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS10740 [old locus tag: SAUSA300_1958 ]
  • symbol: SAUSA300_RS10740
  • product: single-stranded DNA-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2115561..2116031
  • length: 471
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (2115561..2116031) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACT
    CAAAATGGTGTAAATGTAGCATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCA
    CAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTATTTAAAAAACAAGCAGAGAAC
    GTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
    AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATT
    CAATTTTTAGAACCGAAAAACTCAAATGACACTCAACAAGATTTATATCAACAACAAGTA
    CAACAAACACGTGGACAATCGCAATATTCAAATAACAAACCAGTAAAAGATAATCCGTTT
    GCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS10740 [old locus tag: SAUSA300_1958 ]
  • symbol: SAUSA300_RS10740
  • description: single-stranded DNA-binding protein
  • length: 156
  • theoretical pI: 5.26974
  • theoretical MW: 17668.4
  • GRAVY: -0.807692

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 153.5)
    and 1 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair primosomal replication protein PriB (TIGR04418; HMM-score: 26.4)
  • TheSEED:
  • PFAM:
    OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 127.1)
    and 1 more
    tRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 18.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014241
    • TAT(Tat/SPI): 0.002993
    • LIPO(Sec/SPII): 0.002245
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446857497 NCBI
  • RefSeq: WP_000934753 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MLNRTILVGRLTRDPELRTTQNGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]