From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS11240 [old locus tag: SAUSA300_2043 ]
  • pan locus tag?: SAUPAN005363000
  • symbol: SAUSA300_RS11240
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS11240 [old locus tag: SAUSA300_2043 ]
  • symbol: SAUSA300_RS11240
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2207995..2208288
  • length: 294
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGACTGAACAAGATAATGCACATCATTCTGAACAAATAAAAACGAATCTTAAATCACGT
    TTAAATCGAATTGAAGGACAAGTGAGAGCGATTAATCGCATGATTGAAGAAGATGTCTAT
    TGTGATGATGTCCTTACGCAAATAAGAGCGACACGTTCGGCGTTAAACAGTGTTGCGATA
    AAGTTATTAGAACAACATATGAAAAGTTGTATTATGAATAAAGTTAATCAAGGTGCTCAG
    GAAGAGGCAATGGAAGAGTTATTAGTGACTTTTCAAAAATTGATTAAAGACTAA
    60
    120
    180
    240
    294

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS11240 [old locus tag: SAUSA300_2043 ]
  • symbol: SAUSA300_RS11240
  • description: hypothetical protein
  • length: 97
  • theoretical pI: 6.24941
  • theoretical MW: 11197.8
  • GRAVY: -0.548454

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General zinc finger protein ZPR1 homolog (TIGR00340; HMM-score: 14.1)
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage terminase, large subunit, PBSX family (TIGR01547; HMM-score: 12.8)
  • TheSEED: see SAUSA300_2043
  • PFAM:
    no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 97.2)
    and 4 more
    RPM2; Mitochondrial ribonuclease P subunit (RPM2) (PF08579; HMM-score: 15.1)
    YojJ; Bacterial membrane-spanning protein N-terminus (PF10372; HMM-score: 14.8)
    AKAP95; A-kinase anchoring protein 95 (AKAP95) (PF04988; HMM-score: 14)
    Herpes_UL14; Herpesvirus UL14-like protein (PF03580; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003419
    • TAT(Tat/SPI): 0.000516
    • LIPO(Sec/SPII): 0.000463
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTEQDNAHHSEQIKTNLKSRLNRIEGQVRAINRMIEEDVYCDDVLTQIRATRSALNSVAIKLLEQHMKSCIMNKVNQGAQEEAMEELLVTFQKLIKD

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]