From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS12370 [old locus tag: SAUSA300_2241 ]
  • pan locus tag?: SAUPAN005756000
  • symbol: ureE
  • pan gene symbol?: ureE
  • synonym:
  • product: urease accessory protein UreE

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS12370 [old locus tag: SAUSA300_2241 ]
  • symbol: ureE
  • product: urease accessory protein UreE
  • replicon: chromosome
  • strand: +
  • coordinates: 2407914..2408366
  • length: 453
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (2407914..2408366) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGATTGTTGAAGAAATCCAAGGCAATATTGCCAATTTGTCAAATTCAGAAAAACAAAAG
    CACGTCGAAAAAGTATACCTTGAAAATTCAGATCTTGTTAAACGTATTCAAAGAGTCGTT
    ACAGACCATGGCACTGAAATAGGCATTCGTTTAAAACAACCTATTGACTTACAATATGGA
    GATATTTTATACGCAGATGACCATAATATGATTATTGTGGATGTTAATTCAGAAGATCTT
    TTAGTGATTCAACCAAGAACATTGCAAGAAATGGGAGATATAGCCCATCAATTAGGAAAT
    CGTCATTTGCCAGCACAATTTACAGAGACTGAAATGCTAGTACAATATGATTATTTAGTT
    GAAGATTTATTAAAAAGTTTAGGCATCCCATATGTTCGAGAAGACCGTAAAGTTAATAAG
    GCTTTCAGACATATAGGGCATTCTCATGATTGA
    60
    120
    180
    240
    300
    360
    420
    453

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS12370 [old locus tag: SAUSA300_2241 ]
  • symbol: UreE
  • description: urease accessory protein UreE
  • length: 150
  • theoretical pI: 5.23592
  • theoretical MW: 17339.5
  • GRAVY: -0.456

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Central intermediary metabolism Sulfur metabolism sulfate adenylyltransferase, large subunit (TIGR02034; EC 2.7.7.4; HMM-score: 17)
  • TheSEED:
  • PFAM:
    no clan defined UreE_N; UreE urease accessory protein, N-terminal domain (PF02814; HMM-score: 62.5)
    and 2 more
    UreE_C; UreE urease accessory protein, C-terminal domain (PF05194; HMM-score: 40.2)
    ERF; ERF superfamily (PF04404; HMM-score: 12.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003178
    • TAT(Tat/SPI): 0.000188
    • LIPO(Sec/SPII): 0.000954
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446557243 NCBI
  • RefSeq: WP_000634589 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIVEEIQGNIANLSNSEKQKHVEKVYLENSDLVKRIQRVVTDHGTEIGIRLKQPIDLQYGDILYADDHNMIIVDVNSEDLLVIQPRTLQEMGDIAHQLGNRHLPAQFTETEMLVQYDYLVEDLLKSLGIPYVREDRKVNKAFRHIGHSHD

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]