From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS12945 [old locus tag: SAUSA300_2345 ]
  • pan locus tag?: SAUPAN005931000
  • symbol: SAUSA300_RS12945
  • pan gene symbol?: nasE
  • synonym:
  • product: nitrite reductase (NAD(P)H) small subunit

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS12945 [old locus tag: SAUSA300_2345 ]
  • symbol: SAUSA300_RS12945
  • product: nitrite reductase (NAD(P)H) small subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 2521758..2522072
  • length: 315
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (2521758..2522072) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGAAACAAAAGAAAAAATTAAAGTGACAACTATAGATGAATTAACACCCCTAATTGGA
    AAAAAGGTTATTGTCAAAGGCAAAGAGGTAGGGTTGTTTTTAACAGAAAGTGGCAAAATT
    CATGCGATTCACAATATCTGTCCACACAAACAAGGACCATTGTCTGAAGGGACAGTGAGT
    GGGGAATATGTATTTTGCCCGCTCCACGATCAAAAAATTGATTTAAATACAGGTATTGTT
    CAAGAACCTGATGAAGGTTGTGTAGATGTTTATGAGGTAGAAGTTACAGACGGGAACGTA
    TATATATGTCTGTAG
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS12945 [old locus tag: SAUSA300_2345 ]
  • symbol: SAUSA300_RS12945
  • description: nitrite reductase (NAD(P)H) small subunit
  • length: 104
  • theoretical pI: 4.70663
  • theoretical MW: 11437.1
  • GRAVY: -0.106731

Function[edit | edit source]

  • reaction:
    EC 1.7.1.4?  ExPASy
    Nitrite reductase (NAD(P)H) Ammonia + 3 NAD(P)+ + 2 H2O = nitrite + 3 NAD(P)H
  • TIGRFAM:
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrite reductase [NAD(P)H], small subunit (TIGR02378; EC 1.7.1.4; HMM-score: 82.3)
    and 1 more
    Rieske [2Fe-2S] domain protein, MocE subfamily (TIGR02377; HMM-score: 35.7)
  • TheSEED:
  • PFAM:
    ISP-domain (CL0516) Rieske_2; Rieske-like [2Fe-2S] domain (PF13806; HMM-score: 65.1)
    and 1 more
    Rieske; Rieske [2Fe-2S] domain (PF00355; HMM-score: 43)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011677
    • TAT(Tat/SPI): 0.000435
    • LIPO(Sec/SPII): 0.000882
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446370367 NCBI
  • RefSeq: WP_000448222 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGKIHAIHNICPHKQGPLSEGTVSGEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]