From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS13295 [old locus tag: SAUSA300_2401 ]
  • pan locus tag?: SAUPAN006013000
  • symbol: SAUSA300_RS13295
  • pan gene symbol?:
  • synonym:
  • product: Txe/YoeB family addiction module toxin

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS13295 [old locus tag: SAUSA300_2401 ]
  • symbol: SAUSA300_RS13295
  • product: Txe/YoeB family addiction module toxin
  • replicon: chromosome
  • strand: -
  • coordinates: 2586930..2587196
  • length: 267
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGCAATTACACGGTTAAGATTAAAAATTCAGCGAAATCAGATTTAAAGAAAATAAAA
    CATTCTTATTTAAAGAAGTCATTTTTAGAAATTGTTGAGACTTTAAAAAATGATCCGTAT
    AAAATAACACAATCTTTTGAAAAATTAGAGCCTAAATATTTAGAGCGATATTCAAGAAGA
    ATTAACCATCAGCACAGGGTCGTCTATACCGTAGATGATCGAAATAAAGAAGTATTAATA
    CTATCGGCATGGTCACATTATGATTAA
    60
    120
    180
    240
    267


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS13295 [old locus tag: SAUSA300_2401 ]
  • symbol: SAUSA300_RS13295
  • description: Txe/YoeB family addiction module toxin
  • length: 88
  • theoretical pI: 10.1415
  • theoretical MW: 10648.1
  • GRAVY: -0.892045

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 99.4)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 99.4)
    and 2 more
    Cellular processes Cellular processes Toxin production and resistance addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 21.2)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 21.2)
  • TheSEED: see SAUSA300_2401
  • PFAM:
    Plasmid_toxin (CL0136) YoeB_toxin; YoeB-like toxin of bacterial type II toxin-antitoxin system (PF06769; HMM-score: 38.3)
    and 6 more
    ParE_toxin; ParE toxin of type II toxin-antitoxin system, parDE (PF05016; HMM-score: 30.6)
    HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 19.5)
    no clan defined TINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 17.4)
    Met_repress (CL0057) VAPB_antitox; Putative antitoxin (PF02697; HMM-score: 17.2)
    Plasmid_toxin (CL0136) ParE-like_toxin; ParE-like toxin of type II bacterial toxin-antitoxin system (PF15781; HMM-score: 14.9)
    HAD (CL0137) HAD_PNKP; Polynucleotide kinase PNKP phosphatase domain (PF25109; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9833
    • Cytoplasmic Membrane Score: 0.0009
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0152
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004067
    • TAT(Tat/SPI): 0.000204
    • LIPO(Sec/SPII): 0.000498
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSNYTVKIKNSAKSDLKKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLILSAWSHYD

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]