From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS13570 [old locus tag: SAUSA300_2447 ]
  • pan locus tag?: SAUPAN006136000
  • symbol: SAUSA300_RS13570
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS13570 [old locus tag: SAUSA300_2447 ]
  • symbol: SAUSA300_RS13570
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2642008..2642424
  • length: 417
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007793 (2642008..2642424) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGCCCTTTACAATGAAAGGTTACCCCGAAAAATGGAAAGAATTTGAAGTAATTAAACGG
    CAAAAAGCGATAGAAATTGCGAATGCAATGTTAAAAGAAGGATATCTTGAAAAAGATGTT
    GTTCCTATTGCGGCGAAAAAAGCGAAAGATTGGTATCGAGCGTTATCGAAAGAAGAAATC
    AAAGCATTAGAAGAAGAGAACTTCGTACAATTCCATACAGCAACAATGGAAAAAACAGAG
    GTGGATAGTGAATATGCAACAACTGATAATGAAGAACATATTCAAGAACAATCAAATCAA
    GATAAATCGTACTTTGATAGCGAATCAATTGGCAACCAAAGTGGTGGCGTTCGACAAAGA
    GAACCGCTTATGGATGGTCCACATCCAAAAGTTGTGGAATCATTTAAAGACGTATAA
    60
    120
    180
    240
    300
    360
    417

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS13570 [old locus tag: SAUSA300_2447 ]
  • symbol: SAUSA300_RS13570
  • description: hypothetical protein
  • length: 138
  • theoretical pI: 4.71397
  • theoretical MW: 15991.8
  • GRAVY: -0.92971

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    HTH (CL0123) DEP; Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) (PF00610; HMM-score: 14.9)
    Glyoxalase (CL0104) Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 14.3)
    no clan defined Phg_2220_C; Conserved phage C-terminus (Phg_2220_C) (PF09524; HMM-score: 14)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00178
    • TAT(Tat/SPI): 0.000255
    • LIPO(Sec/SPII): 0.000323
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 447039798 NCBI
  • RefSeq: WP_001117054 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MPFTMKGYPEKWKEFEVIKRQKAIEIANAMLKEGYLEKDVVPIAAKKAKDWYRALSKEEIKALEEENFVQFHTATMEKTEVDSEYATTDNEEHIQEQSNQDKSYFDSESIGNQSGGVRQREPLMDGPHPKVVESFKDV

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]