From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14245 [old locus tag: SAUSA300_2560 ]
  • pan locus tag?: SAUPAN006340000
  • symbol: SAUSA300_RS14245
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS14245 [old locus tag: SAUSA300_2560 ]
  • symbol: SAUSA300_RS14245
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2770658..2770858
  • length: 201
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATACTAGTAATGTTATCTCCATTATTAATCATATTCTTTATAGTGTTGTCTATTTTA
    GAAGAGCGTAAACGTACGAAGAAAAAGCAACTCGAGAAAGAAAAAGCAAATACACTAAAT
    CAAAATACAAATGACACGGAAAGTTCAAATCAAGAGCCGTCATTGCAGCAGGATAAAGAA
    CAAAAAGATAACAAAGGATAA
    60
    120
    180
    201


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS14245 [old locus tag: SAUSA300_2560 ]
  • symbol: SAUSA300_RS14245
  • description: hypothetical protein
  • length: 66
  • theoretical pI: 9.17593
  • theoretical MW: 7687.8
  • GRAVY: -0.836364

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 14)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AF (TIGR02896; HMM-score: 12.3)
    and 1 more
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 10.1)
  • TheSEED: see SAUSA300_2560
  • PFAM:
    no clan defined DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 21.1)
    TMEM154; TMEM154 protein family (PF15102; HMM-score: 19.7)
    TMEM156; TMEM156 protein family (PF15106; HMM-score: 17)
    and 17 more
    Transporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 16.6)
    no clan defined Di19_C; Stress-induced protein Di19, C-terminal (PF14571; HMM-score: 16.1)
    Cadherin_C_2; Cadherin cytoplasmic C-terminal (PF16492; HMM-score: 15.5)
    Ctr; Ctr copper transporter family (PF04145; HMM-score: 15.2)
    TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 15.2)
    no clan defined GPR15L; G-protein coupled receptor ligand 15 (PF15854; HMM-score: 15)
    DUF6724; Family of unknown function (DUF6724) (PF20485; HMM-score: 14.8)
    PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 14.5)
    DUF6249; Domain of unknown function (DUF6249) (PF19762; HMM-score: 13.1)
    GRP; Glycine rich protein family (PF07172; HMM-score: 12.6)
    YajC; Preprotein translocase subunit (PF02699; HMM-score: 12.4)
    MFS (CL0015) SLC52_ribofla_tr; Solute carrier family 52, riboflavin transporter (PF06237; HMM-score: 12.2)
    no clan defined MotB_plug; Membrane MotB of proton-channel complex MotA/MotB (PF13677; HMM-score: 12.1)
    MFS (CL0015) CLN3; CLN3 protein (PF02487; HMM-score: 12)
    no clan defined Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 11.9)
    OAD_gamma; Oxaloacetate decarboxylase, gamma chain (PF04277; HMM-score: 11.6)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 10.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9973
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0027
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.257112
    • TAT(Tat/SPI): 0.001775
    • LIPO(Sec/SPII): 0.196041
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQDKEQKDNKG

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]