Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS14670 [old locus tag: SAUSA300_2642 ]
- pan locus tag?: SAUPAN006482000
- symbol: SAUSA300_RS14670
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS14670 [old locus tag: SAUSA300_2642 ]
- symbol: SAUSA300_RS14670
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2866102..2866455
- length: 354
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (2866102..2866455) NCBI
- BioCyc: SAUSA300_RS14670 BioCyc
- MicrobesOnline: see SAUSA300_2642
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTTTCAATTGGAAGTGCAATTCTTCATTTTGTCATTGGTGGTATCGCTGTTGCATTA
GCTTCAATTATTGCTGATAAGGTAGGTGGTAAGTTAGGAGGTATTATAGCTACTATGCCG
GCAGTCTTTCTTGCGGCTATTATCGCATTAGCTTTAGATCATCGTGGTACGCAATTAGTG
GAGATGTCGATGAATCTTAGTACTGGAGCAATTGTCGGTATTCTGTCTTGTATATTAACT
GTATTTTTGACATCTCTCTACATTAAGCATAAAGGTTATCGGAAAGGCGCAATATTCACA
GTTGTTTGTTGGTTTGTCATTTCCCTCGCAATATTCAGTATTAGACATTTATAG60
120
180
240
300
354
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS14670 [old locus tag: SAUSA300_2642 ]
- symbol: SAUSA300_RS14670
- description: hypothetical protein
- length: 117
- theoretical pI: 10.178
- theoretical MW: 12330.9
- GRAVY: 1.2735
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Unknown substrate MFS transporter, metabolite:H+ symporter (MHS) family protein (TIGR00883; HMM-score: 13.5)and 1 moreoligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 5.4)
- TheSEED: see SAUSA300_2642
- PFAM: GlpM-like (CL0420) DUF3147; Protein of unknown function (DUF3147) (PF11345; HMM-score: 153.5)and 3 moreno clan defined Chromate_transp; Chromate transporter (PF02417; HMM-score: 13.3)DUF485; Protein of unknown function, DUF485 (PF04341; HMM-score: 9.1)DUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9992
- Cell wall & surface Score: 0
- Extracellular Score: 0.0007
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.09323
- TAT(Tat/SPI): 0.004443
- LIPO(Sec/SPII): 0.033966
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
- GI: 446413527 NCBI
- RefSeq: WP_000491382 NCBI
- UniProt: see SAUSA300_2642
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFSIGSAILHFVIGGIAVALASIIADKVGGKLGGIIATMPAVFLAAIIALALDHRGTQLVEMSMNLSTGAIVGILSCILTVFLTSLYIKHKGYRKGAIFTVVCWFVISLAIFSIRHL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]