From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14765 [old locus tag: SAUSA300_pUSA030006 ]
  • pan locus tag?:
  • symbol: SAUSA300_RS14765
  • pan gene symbol?:
  • synonym:
  • product: replication and maintenance protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS14765 [old locus tag: SAUSA300_pUSA030006 ]
  • symbol: SAUSA300_RS14765
  • product: replication and maintenance protein
  • replicon: pUSA03
  • strand: +
  • coordinates: 6681..7157
  • length: 477
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_007792 (6681..7157) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAAGAAAGATATGGAACAGTCTATAAAGGCTCTCAGAGGCTCATAGACGAAGAAAGT
    GGAGAAGTCATAGAGGTAGACAAGTTATACCGTAAACAAACGTCTGGTAACTTCGTAAAG
    GCATATATAGTGCAATTAATAAGTATGTTAGATATGATTGGCGGAAAAAAACTTAAAATC
    GTTAACTATATCCTAGATAATGTCCACTTAAGTAACAATACAATGATAGCTACAACAAGA
    GAAATAGCAAAAGCTACAGGAACAAGTCTACAAACAGTAATAACAACACTTAAAATCTTA
    GAAGAAGGAAATATTATAAAAAGAAAAACTGGAGTATTAATGTTAAACCCTGAACTACTA
    ATGAGAGGCGACGACCAAAAACAAAAATACCTCTTACTCGAATTTGGGAACTTTGAGCAA
    GAGGCAAATGAAAAACAAGAAAATGCATTATCTGATTATTATTCTTTCAAGGACTAG
    60
    120
    180
    240
    300
    360
    420
    477

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS14765 [old locus tag: SAUSA300_pUSA030006 ]
  • symbol: SAUSA300_RS14765
  • description: replication and maintenance protein
  • length: 158
  • theoretical pI: 7.49276
  • theoretical MW: 18078.7
  • GRAVY: -0.411392

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 14.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 13.8)
    Signal transduction Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 13.8)
  • TheSEED:
  • PFAM:
    HTH (CL0123) RepL; Firmicute plasmid replication protein (RepL) (PF05732; HMM-score: 233.3)
    and 12 more
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 25.1)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 24.6)
    FUR; Ferric uptake regulator family (PF01475; HMM-score: 17.1)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 16.4)
    MarR; MarR family (PF01047; HMM-score: 14.3)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 14)
    HTH_11; HTH domain (PF08279; HMM-score: 13.6)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 13.5)
    GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 13.4)
    FaeA; FaeA-like protein (PF04703; HMM-score: 12.8)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 12.6)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 12.6)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002149
    • TAT(Tat/SPI): 0.000167
    • LIPO(Sec/SPII): 0.000509
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446587381 NCBI
  • RefSeq: WP_000664727 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKERYGTVYKGSQRLIDEESGEVIEVDKLYRKQTSGNFVKAYIVQLISMLDMIGGKKLKIVNYILDNVHLSNNTMIATTREIAKATGTSLQTVITTLKILEEGNIIKRKTGVLMLNPELLMRGDDQKQKYLLLEFGNFEQEANEKQENALSDYYSFKD

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]