Jump to navigation
Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS14790 [old locus tag: SAUSA300_pUSA030011 ]
- pan locus tag?:
- symbol: SAUSA300_RS14790
- pan gene symbol?: —
- synonym:
- product: membrane protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS14790 [old locus tag: SAUSA300_pUSA030011 ]
- symbol: SAUSA300_RS14790
- product: membrane protein
- replicon: pUSA03
- strand: +
- coordinates: 11030..11347
- length: 318
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_007792 (11030..11347) NCBI
- BioCyc: SAUSA300_RS14790 BioCyc
- MicrobesOnline: see SAUSA300_pUSA030011
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGATTAAAAAATTCAGTTTAACAACTGTTTATGTAGCATTTTTAAGCATTGTTTTATCA
AATATAACACTTGGCGCAGAAAATCCAGGGCCGAAAATTGAACAAGGTTTACAACAAGTA
CAAACATTCTTAACAGGCCTAATTGTTGCTGTTGGTATCTGTGCTGGTGTTTGGATAGTT
CTTAAAAAATTACCTGGAATTGATGATCCAATGGTAAAAAATGAAATGTTTAGAGGCGTT
GGAATGGTATTAGCTGGTGTGGCTGTTGGGGCAGCACTTGTTTGGTTGGTTCCATGGGTA
TACAACCTTTTCCAATAA60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_RS14790 [old locus tag: SAUSA300_pUSA030011 ]
- symbol: SAUSA300_RS14790
- description: membrane protein
- length: 105
- theoretical pI: 9.19725
- theoretical MW: 11317.6
- GRAVY: 0.862857
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAUSA300_pUSA030011
- PFAM: TrbC_VirB2 (CL0690) T4SS_CagC; Cag pathogenicity island, type IV secretory system (PF16943; HMM-score: 55.4)and 7 moreTrbC; TrbC/VIRB2 pilin (PF04956; HMM-score: 22.9)Maff2; Maff2 family (PF12750; HMM-score: 13)no clan defined SecE; SecE/Sec61-gamma subunits of protein translocation complex (PF00584; HMM-score: 12.6)PH (CL0266) bPH_10; YqeB-like bacterial PH domain (PF23494; HMM-score: 9.7)no clan defined DUF4349; Domain of unknown function (DUF4349) (PF14257; HMM-score: 8.1)DUF6479; Family of unknown function (DUF6479) (PF20087; HMM-score: 7.9)TrbC_VirB2 (CL0690) T4SS_pilin; Type IV secretion system pilin (PF18895; HMM-score: 7.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.4601
- Cell wall & surface Score: 0
- Extracellular Score: 0.5397
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 25 aa
- SP(Sec/SPI): 0.696851
- TAT(Tat/SPI): 0.001428
- LIPO(Sec/SPII): 0.076762
- Cleavage Site: CS pos: 25-26. TLG-AE. Pr: 0.4498
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI: 446514276 NCBI
- RefSeq: WP_000591622 NCBI
- UniProt: see SAUSA300_pUSA030011
⊟Protein sequence[edit | edit source]
- MIKKFSLTTVYVAFLSIVLSNITLGAENPGPKIEQGLQQVQTFLTGLIVAVGICAGVWIVLKKLPGIDDPMVKNEMFRGVGMVLAGVAVGAALVWLVPWVYNLFQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]