From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14790 [old locus tag: SAUSA300_pUSA030011 ]
  • pan locus tag?:
  • symbol: SAUSA300_RS14790
  • pan gene symbol?:
  • synonym:
  • product: membrane protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS14790 [old locus tag: SAUSA300_pUSA030011 ]
  • symbol: SAUSA300_RS14790
  • product: membrane protein
  • replicon: pUSA03
  • strand: +
  • coordinates: 11030..11347
  • length: 318
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATTAAAAAATTCAGTTTAACAACTGTTTATGTAGCATTTTTAAGCATTGTTTTATCA
    AATATAACACTTGGCGCAGAAAATCCAGGGCCGAAAATTGAACAAGGTTTACAACAAGTA
    CAAACATTCTTAACAGGCCTAATTGTTGCTGTTGGTATCTGTGCTGGTGTTTGGATAGTT
    CTTAAAAAATTACCTGGAATTGATGATCCAATGGTAAAAAATGAAATGTTTAGAGGCGTT
    GGAATGGTATTAGCTGGTGTGGCTGTTGGGGCAGCACTTGTTTGGTTGGTTCCATGGGTA
    TACAACCTTTTCCAATAA
    60
    120
    180
    240
    300
    318

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS14790 [old locus tag: SAUSA300_pUSA030011 ]
  • symbol: SAUSA300_RS14790
  • description: membrane protein
  • length: 105
  • theoretical pI: 9.19725
  • theoretical MW: 11317.6
  • GRAVY: 0.862857

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAUSA300_pUSA030011
  • PFAM:
    TrbC_VirB2 (CL0690) T4SS_CagC; Cag pathogenicity island, type IV secretory system (PF16943; HMM-score: 55.4)
    and 7 more
    TrbC; TrbC/VIRB2 pilin (PF04956; HMM-score: 22.9)
    Maff2; Maff2 family (PF12750; HMM-score: 13)
    no clan defined SecE; SecE/Sec61-gamma subunits of protein translocation complex (PF00584; HMM-score: 12.6)
    PH (CL0266) bPH_10; YqeB-like bacterial PH domain (PF23494; HMM-score: 9.7)
    no clan defined DUF4349; Domain of unknown function (DUF4349) (PF14257; HMM-score: 8.1)
    DUF6479; Family of unknown function (DUF6479) (PF20087; HMM-score: 7.9)
    TrbC_VirB2 (CL0690) T4SS_pilin; Type IV secretion system pilin (PF18895; HMM-score: 7.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0002
    • Cytoplasmic Membrane Score: 0.4601
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.5397
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 25 aa
    • SP(Sec/SPI): 0.696851
    • TAT(Tat/SPI): 0.001428
    • LIPO(Sec/SPII): 0.076762
    • Cleavage Site: CS pos: 25-26. TLG-AE. Pr: 0.4498
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIKKFSLTTVYVAFLSIVLSNITLGAENPGPKIEQGLQQVQTFLTGLIVAVGICAGVWIVLKKLPGIDDPMVKNEMFRGVGMVLAGVAVGAALVWLVPWVYNLFQ

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]