Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS00445 [old locus tag: SA0060 ]
- pan locus tag?: SAUPAN000447000
- symbol: SA_RS00445
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS00445 [old locus tag: SA0060 ]
- symbol: SA_RS00445
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 68423..68719
- length: 297
- essential: no DEG
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTATTTCAATCAATCAGATAAATTCGAGCAGTTAAAAAAGAAAATATTAGGTATTTCA
TTCAATTTACCTGAAGGAGAAGAATTTACATTTCATGACTTGAACAGTCGTGCAAATGTA
CAATGTTCAAAAGCTGTACAACAAAATGTTGGACGTTGGTTCGCATATTTTGTAAAACAT
GCGCCACGTGTTCCATTTATTATTATCGGTAAGGATACTCACGGTCACTTAGTTTATCTT
AAAACAGGTCCTAATCCACACTATAACAGCAACCCTTCGAAAGGAGGTGTTCGCTAA60
120
180
240
297
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS00445 [old locus tag: SA0060 ]
- symbol: SA_RS00445
- description: hypothetical protein
- length: 98
- theoretical pI: 10.1981
- theoretical MW: 11235.7
- GRAVY: -0.573469
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SA0060
- PFAM: no clan defined DUF1413; Domain of unknown function (DUF1413) (PF07205; HMM-score: 66.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9417
- Cytoplasmic Membrane Score: 0.003
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0548
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007517
- TAT(Tat/SPI): 0.000937
- LIPO(Sec/SPII): 0.00138
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MYFNQSDKFEQLKKKILGISFNLPEGEEFTFHDLNSRANVQCSKAVQQNVGRWFAYFVKHAPRVPFIIIGKDTHGHLVYLKTGPNPHYNSNPSKGGVR
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]